BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0347 (759 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 25 0.66 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 25 0.66 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 4.6 AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory recept... 22 4.6 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 25.0 bits (52), Expect = 0.66 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 196 YVLGNYSLS*-FQLCRYCMHDVLKTQTLFGQI*LYIFFTRFFCVIISTIL 342 Y LGN S + F L Y + L QT+ QI + F ++IST L Sbjct: 190 YFLGNMSFAHIFALVEYDIFKALVLQTINLQITFIWTYNDLFVMLISTAL 239 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 25.0 bits (52), Expect = 0.66 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 196 YVLGNYSLS*-FQLCRYCMHDVLKTQTLFGQI*LYIFFTRFFCVIISTIL 342 Y LGN S + F L Y + L QT+ QI + F ++IST L Sbjct: 190 YFLGNMSFAHIFALVEYDIFKALVLQTINLQITFIWTYNDLFVMLISTAL 239 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 227 FNCVDIACTMY*-KPKHYLVKYNYIYFLHDFSVLSYQPFLIFQNDSMV 367 F V CT + L+ YN I + S +SY +L+ + D M+ Sbjct: 24 FGFVTFTCTRSNFRSSKLLILYNIILQVLFVSFVSYWLYLVLEADDML 71 >AM292324-1|CAL23136.1| 398|Tribolium castaneum gustatory receptor candidate 3 protein. Length = 398 Score = 22.2 bits (45), Expect = 4.6 Identities = 14/48 (29%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 227 FNCVDIACTMY*-KPKHYLVKYNYIYFLHDFSVLSYQPFLIFQNDSMV 367 F V CT + L+ YN I + S +SY +L+ + D M+ Sbjct: 42 FGFVTFTCTRSNFRSSKLLILYNIILQVLFVSFVSYWLYLVLEADDML 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,908 Number of Sequences: 336 Number of extensions: 4274 Number of successful extensions: 12 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -