BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0342 (791 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.9 DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 23 3.3 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 9.9 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.9 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.9 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.9 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 1.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 261 LSFHHHLSQNHHPLR 305 L HHHL +HH L+ Sbjct: 138 LQRHHHLQNHHHHLQ 152 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +3 Query: 450 CHPDINKLVTRPLELLF 500 CHPDI + V + L+ +F Sbjct: 366 CHPDIQEKVIQELDEIF 382 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/34 (20%), Positives = 19/34 (55%) Frame = +1 Query: 307 NNKFFRHHVYHMIAFNMAFKIYIKMSFSYITFYI 408 + +++ H + + ++ FK+ +M F + +YI Sbjct: 207 SQQYYGHFAGNFSSISITFKLAREMGFFMMDYYI 240 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 81 PSVCLFVFRLNIIR 40 P++C+ VF NII+ Sbjct: 500 PAICVGVFTFNIIK 513 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.4 bits (43), Expect = 9.9 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 81 PSVCLFVFRLNIIR 40 P++C+ VF NII+ Sbjct: 553 PAICVGVFTFNIIK 566 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.9 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 668 TLQTENALLLHGRNRQGGGTYPRGLT 591 T T +++LLH ++ GG G T Sbjct: 1413 TSSTSSSILLHWKSGHNGGASLTGYT 1438 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.9 Identities = 9/26 (34%), Positives = 14/26 (53%) Frame = -1 Query: 668 TLQTENALLLHGRNRQGGGTYPRGLT 591 T T +++LLH ++ GG G T Sbjct: 1409 TSSTSSSILLHWKSGHNGGASLTGYT 1434 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,254 Number of Sequences: 438 Number of extensions: 4614 Number of successful extensions: 12 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -