BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0341 (746 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 26 0.33 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 25 0.75 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 25 1.00 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 25 1.00 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 25 1.00 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 9.3 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 26.2 bits (55), Expect = 0.33 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 250 AGPNTHFGGVQLGFFNSS 197 +GP GGV+LG+FN S Sbjct: 55 SGPEESSGGVELGWFNDS 72 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 25.0 bits (52), Expect = 0.75 Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 2/42 (4%) Frame = +3 Query: 219 WTPPKWVFGPAWTVLYSSMGYASYLIWEECDGF--TEDAVLP 338 W ++ AW + Y M S L W C+ + T++ V P Sbjct: 72 WMNVYYIVILAWAIFYFFMSMRSELPWGSCNNYWNTKNCVNP 113 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 24.6 bits (51), Expect = 1.00 Identities = 11/34 (32%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -3 Query: 285 RHIPCCCREQSKLDQIPTLGES--SLASLTHHTR 190 +H CCR + + GES L + HTR Sbjct: 53 KHTDACCRTHDMCPDVMSAGESKHGLTNTASHTR 86 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 24.6 bits (51), Expect = 1.00 Identities = 11/34 (32%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -3 Query: 285 RHIPCCCREQSKLDQIPTLGES--SLASLTHHTR 190 +H CCR + + GES L + HTR Sbjct: 58 KHTDACCRTHDMCPDVMSAGESKHGLTNTASHTR 91 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 24.6 bits (51), Expect = 1.00 Identities = 11/34 (32%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = -3 Query: 285 RHIPCCCREQSKLDQIPTLGES--SLASLTHHTR 190 +H CCR + + GES L + HTR Sbjct: 58 KHTDACCRTHDMCPDVMSAGESKHGLTNTASHTR 91 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +3 Query: 501 LLIPYLAWLGYASS 542 +L+P L WLG+ +S Sbjct: 339 ILMPALTWLGWINS 352 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,102 Number of Sequences: 438 Number of extensions: 5214 Number of successful extensions: 11 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -