BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0339 (776 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 26 0.39 AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory recept... 22 6.3 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 25.8 bits (54), Expect = 0.39 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 186 SSNAFRFEGWGSRCSCTEILELISQGGWRI 97 + N+ ++ G EI+EL +GGW++ Sbjct: 284 AGNSGKYTGEAGMLGYNEIVELQKEGGWKV 313 >AM292357-1|CAL23169.2| 355|Tribolium castaneum gustatory receptor candidate 36 protein. Length = 355 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 685 VMYVDLPVINKNESCVLNQEE 623 V V +P + SC+LNQ++ Sbjct: 83 VFTVAIPFVGIANSCILNQDK 103 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,662 Number of Sequences: 336 Number of extensions: 3228 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20961338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -