BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0336 (746 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 pr... 26 1.4 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 24 4.3 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 24 5.7 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 7.6 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 7.6 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 7.6 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 7.6 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 7.6 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 7.6 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 7.6 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 7.6 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 7.6 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 7.6 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 7.6 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 7.6 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 7.6 AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylch... 23 7.6 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 7.6 >AY748838-1|AAV28186.1| 155|Anopheles gambiae cytochrome P450 protein. Length = 155 Score = 25.8 bits (54), Expect = 1.4 Identities = 11/46 (23%), Positives = 23/46 (50%) Frame = +3 Query: 222 GYHLRGNEVMYNGHTGRKINAQVFLGPTYYQRLKHMVDDKIHSRAR 359 GYH+ + ++ G ++ ++ PT + + + D KIH A+ Sbjct: 65 GYHIPKDTMLVGMFRGMMLDENLWENPTQFNPERFLKDGKIHIPAQ 110 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 24.2 bits (50), Expect = 4.3 Identities = 14/51 (27%), Positives = 23/51 (45%) Frame = -2 Query: 478 RKNWAAPCAI*QSRSISPKRNPPSLALPSIGCLTRICTGPLALE*ILSSTM 326 R W A A+ + ++NPP+ +G L +C +E I S+ M Sbjct: 319 RSIWRAWTALQDLTDVPIRKNPPTSGFIGLGLLLPVCRYIDVVEYIPSTRM 369 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.8 bits (49), Expect = 5.7 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = +2 Query: 194 KNIISVTRLWLPSTW**SHVQW 259 KN I T LW+ TW ++W Sbjct: 66 KNQIMTTNLWVEQTWYDYKLKW 87 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 456 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 492 >AY705402-1|AAU12511.1| 509|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 7 protein. Length = 509 Score = 23.4 bits (48), Expect = 7.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 194 KNIISVTRLWLPSTW**SHVQW 259 KN + +T +WL W +V+W Sbjct: 49 KNQLLITNIWLKLEWNDMNVRW 70 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.4 bits (48), Expect = 7.6 Identities = 11/37 (29%), Positives = 20/37 (54%) Frame = +3 Query: 123 QGKVSSNKGEIGDATPFNDAVNVQKISSLLQDYGYHL 233 Q +++ G + DA+PF V+ + + D+G HL Sbjct: 440 QRLINNIVGHLKDASPFLQERAVKNFAMVDADFGRHL 476 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 813,193 Number of Sequences: 2352 Number of extensions: 17485 Number of successful extensions: 262 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 262 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76923555 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -