BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0335 (818 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC18B11.11 ||SPAC1F5.01|GTPase activating protein |Schizosacch... 28 1.8 SPAC9G1.06c |cyk3||cytokinesis protein Cyk3|Schizosaccharomyces ... 26 5.6 SPBC342.01c |alg6|SPBC3F6.06c|glucosyltransferase Alg6|Schizosac... 26 7.4 SPAC1565.02c |||GTPase activating protein|Schizosaccharomyces po... 25 9.8 SPAC5D6.07c |||PXA domain protein|Schizosaccharomyces pombe|chr ... 25 9.8 SPBC2G2.08 |ade9||C-1-tetrahydrofolatesynthase/methylenetetrahyd... 25 9.8 >SPAC18B11.11 ||SPAC1F5.01|GTPase activating protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1294 Score = 27.9 bits (59), Expect = 1.8 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -3 Query: 558 TRDIITNKLRLRIDARLNFIWTHTRQR*RSTKTKFDDRLFL 436 T+DII NK+ I A +WTH ++ + + DDR L Sbjct: 48 TKDIIENKVHGNILAATISLWTHAAEKHKEMSS--DDRALL 86 >SPAC9G1.06c |cyk3||cytokinesis protein Cyk3|Schizosaccharomyces pombe|chr 1|||Manual Length = 886 Score = 26.2 bits (55), Expect = 5.6 Identities = 24/80 (30%), Positives = 40/80 (50%), Gaps = 12/80 (15%) Frame = +2 Query: 266 YQFTINIKELLRSVKLYCYVT---TKGNVHIYYQ---NLNSFFF*V-----ISSITVIFA 412 ++ + +KE+L+++ L+C V K IYY N+N + V + I FA Sbjct: 537 FEVALLVKEMLQALDLWCEVIEGYLKSPDDIYYTRDININHAWNVVTFDNEVRLIDASFA 596 Query: 413 AKSYPSAARKRRSSN-FVFV 469 + ++P A K SSN F F+ Sbjct: 597 SPTHPQQALKSSSSNDFYFL 616 >SPBC342.01c |alg6|SPBC3F6.06c|glucosyltransferase Alg6|Schizosaccharomyces pombe|chr 2|||Manual Length = 506 Score = 25.8 bits (54), Expect = 7.4 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = -2 Query: 358 LIINMYITFCRNITI*FYTA*KLLYINSKLVIPIKD 251 +I+N+ ++F TI +T +LL+I+SKL +++ Sbjct: 467 VILNVTLSFAGFFTIYLWTLGRLLHISSKLSTDLRN 502 >SPAC1565.02c |||GTPase activating protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 374 Score = 25.4 bits (53), Expect = 9.8 Identities = 8/15 (53%), Positives = 13/15 (86%) Frame = +3 Query: 417 NHIHRLQEKDDRQTS 461 NH+H+L +KD+R T+ Sbjct: 46 NHVHKLIQKDERYTA 60 >SPAC5D6.07c |||PXA domain protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 495 Score = 25.4 bits (53), Expect = 9.8 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 2/56 (3%) Frame = +2 Query: 212 KTTLKNTPLSEKKI-LDRYYQFTINIKELLRSVKLYCYVTTK-GNVHIYYQNLNSF 373 +T +N+ + K+ +D Y Q + I L S KL V ++ N HI+Y LNSF Sbjct: 429 QTPSENSAATLKQAAIDAYSQIPV-IPFFLPSDKLIMLVESEYRNKHIFYSLLNSF 483 >SPBC2G2.08 |ade9||C-1- tetrahydrofolatesynthase/methylenetetrahydrofolatedehydr ogenase/methylenetetrahydrofolatecyclohydrolase/formylte trahydrofolatesynthetase|Schizosaccharomyces pombe|chr 2|||Manual Length = 969 Score = 25.4 bits (53), Expect = 9.8 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -1 Query: 749 RHFEDCSNFNAPFTLNIDSY 690 +H ++C FN P + I+SY Sbjct: 773 KHIQNCHKFNIPVVVAINSY 792 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,065,331 Number of Sequences: 5004 Number of extensions: 59945 Number of successful extensions: 113 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 111 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 400438000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -