BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0335 (818 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05130.1 68416.m00557 expressed protein ; expression supporte... 28 6.5 At3g28007.1 68416.m03496 nodulin MtN3 family protein contains Pf... 28 8.6 >At3g05130.1 68416.m00557 expressed protein ; expression supported by MPSS Length = 634 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +2 Query: 374 FF*VISSITVIFAAKSYPSAARKR 445 F+ ++SS+T +FAA S+ AAR R Sbjct: 611 FWTLVSSVTTVFAAASFAYAARAR 634 >At3g28007.1 68416.m03496 nodulin MtN3 family protein contains Pfam PF03083 MtN3/saliva family; similar to LIM7 GI:431154 (induced in meiotic prophase in lily microsporocytes) from [Lilium longiflorum] Length = 251 Score = 27.9 bits (59), Expect = 8.6 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = -2 Query: 691 IYYALYFKLNLIL*TKSQKSIQR*VSVRHLPFDTSIMNFINAVI 560 I+ ++ L I + + SV+++PF S+ NF+N V+ Sbjct: 136 IFCVIFVSLMYIAPLTIMSKVIKTKSVKYMPFSLSLANFLNGVV 179 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,052,173 Number of Sequences: 28952 Number of extensions: 275710 Number of successful extensions: 406 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 406 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1872844800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -