BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0331 (830 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyc... 28 1.4 SPAC3A12.19 |||mitochondrial ribosomal protein subunit L27|Schiz... 27 3.3 SPBC1709.08 |cft1||cleavage factor one Cft1 |Schizosaccharomyces... 27 4.3 SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytoch... 25 10.0 SPBC29A3.17 |gef3||RhoGEF Gef3|Schizosaccharomyces pombe|chr 2||... 25 10.0 SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion ... 25 10.0 >SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1238 Score = 28.3 bits (60), Expect = 1.4 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%) Frame = +2 Query: 575 KDDSRNLGRFYDSGAEDISS--SGSDCSTGTRGEERTDHALR 694 K+D+ + + DSG D SG+D S GEE++ AL+ Sbjct: 786 KEDASSTKQAKDSGTNDFDKLISGNDVSKNNSGEEQSRSALK 827 >SPAC3A12.19 |||mitochondrial ribosomal protein subunit L27|Schizosaccharomyces pombe|chr 1|||Manual Length = 93 Score = 27.1 bits (57), Expect = 3.3 Identities = 14/35 (40%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = -2 Query: 232 PMSTKVGISFHKGANR-LNGERFSHGN--VNWSSV 137 PM+TK+G ++KG G++ HG V WS V Sbjct: 14 PMTTKLGHQYYKGTRTGKMGQKTRHGGFLVQWSRV 48 >SPBC1709.08 |cft1||cleavage factor one Cft1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1441 Score = 26.6 bits (56), Expect = 4.3 Identities = 12/34 (35%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +3 Query: 123 QPVSITDDQFTFPWLNLSPFSLFAPL-WKLIPTF 221 +P +ITDD P N L +PL W +I ++ Sbjct: 1058 EPYAITDDNDYLPMANTGSLDLVSPLTWTVIDSY 1091 >SPAC1420.04c |cox1101|cox11, SPAPB17E12.01c, cox11|fusion cytochrome c oxidase assembly protein Cox1101, mitochondrial ribosomal protein Rsm22|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 25.4 bits (53), Expect = 10.0 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +3 Query: 432 DVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETGAPYK 557 D+ +L ++ L ++AP + +T +V+ + PY+ Sbjct: 111 DIKKDLATESQLPLSAPFKDESTRTMTDPQVLAYIHQSMPYQ 152 >SPBC29A3.17 |gef3||RhoGEF Gef3|Schizosaccharomyces pombe|chr 2|||Manual Length = 525 Score = 25.4 bits (53), Expect = 10.0 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 394 KNWLANTSWSSSLASCDPWTKIKS 323 + W+ N+S S L CD KI+S Sbjct: 187 EKWMKNSSISEYLQECDSMAKIES 210 >SPAC19B12.13 |cox1102|cox11, cox11-b, cox11, SPAPB8E5.01|fusion cytochrome c oxidase assembly protein Cox1102, mitochondrial ribosomal protein Rsm2202|Schizosaccharomyces pombe|chr 1|||Manual Length = 753 Score = 25.4 bits (53), Expect = 10.0 Identities = 9/42 (21%), Positives = 21/42 (50%) Frame = +3 Query: 432 DVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETGAPYK 557 D+ +L ++ L ++AP + +T +V+ + PY+ Sbjct: 111 DIKKDLATESQLPLSAPFKDESTRTMTDPQVLAYIHQSMPYQ 152 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,733,660 Number of Sequences: 5004 Number of extensions: 48209 Number of successful extensions: 160 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 408446760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -