BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0331 (830 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0596 - 26497863-26497913,26498010-26498081,26499015-264990... 29 3.4 04_04_0201 - 23555336-23556008,23556097-23556258,23556353-235572... 29 3.4 03_03_0216 + 15495395-15495566,15495648-15495733,15495824-154958... 29 4.5 06_02_0341 + 14778915-14778961,14778982-14779860,14780101-14782804 29 6.0 06_01_0520 + 3761990-3762327,3763304-3763589,3763746-3763820,376... 29 6.0 03_05_0136 + 21158917-21159939,21160183-21160241,21160259-211602... 29 6.0 01_01_0092 + 722744-723459,723542-723711,723792-724885 29 6.0 >04_04_0596 - 26497863-26497913,26498010-26498081,26499015-26499093, 26499440-26499553,26499822-26499871,26500353-26500398, 26501100-26501719 Length = 343 Score = 29.5 bits (63), Expect = 3.4 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = +2 Query: 536 RDWRSVQEGRACRKDDSRNLGRFYDSGAEDIS-SSGSDCSTGTRGEERTDHALRTR*SDR 712 R R ++ R R+ SR+ S +E S SS SDCS G+ E ++ R R R Sbjct: 79 RKRRRKEKERRHRRRRSRSASSGSSSESESESESSYSDCSAGSESETDSEEERRRRRRRR 138 Query: 713 KRQRDPTRKR 742 +R+ +R Sbjct: 139 RRKEREEEER 148 >04_04_0201 - 23555336-23556008,23556097-23556258,23556353-23557206, 23557452-23557613,23558197-23558649,23559729-23559788, 23559983-23560058,23561546-23561593,23561948-23562022, 23562067-23562494 Length = 996 Score = 29.5 bits (63), Expect = 3.4 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 4/74 (5%) Frame = +3 Query: 399 TYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETGAPYKKDEPVEK 578 T S+ V+ AA + +G + VT+ +S+ VD+ V+P+ A + DE K Sbjct: 659 TASMQVHEGAAAAQLGESPEG-VDVTSAVSDEVDRDDKATHVLPLAAAAADGESDELERK 717 Query: 579 ----TTVETLDVST 608 + T+D+ST Sbjct: 718 RRKLDSCATMDMST 731 >03_03_0216 + 15495395-15495566,15495648-15495733,15495824-15495874, 15496005-15496390,15496760-15496898,15497540-15497595, 15497712-15497782,15497876-15498081 Length = 388 Score = 29.1 bits (62), Expect = 4.5 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +2 Query: 542 WRSVQEGRACRKDDSRNLGRFYDSGAEDISSSGSDCSTG 658 WR + +A D LG+ Y +E++S+S SDC +G Sbjct: 2 WRFLGASKALTSSDVWFLGKCYKLSSEELSNS-SDCESG 39 >06_02_0341 + 14778915-14778961,14778982-14779860,14780101-14782804 Length = 1209 Score = 28.7 bits (61), Expect = 6.0 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 5/47 (10%) Frame = -3 Query: 660 VPVLQSLPLELMSSAPES*K----RPRFLLSSFLQARPS-CTERQSR 535 V VLQS+P + SS+P S K P F+ SS ++R S C ++ R Sbjct: 256 VVVLQSVPTQQQSSSPSSSKLRADAPEFIPSSIKKSRASRCKAKKKR 302 >06_01_0520 + 3761990-3762327,3763304-3763589,3763746-3763820, 3764013-3764961,3766967-3767064,3768144-3768284, 3768758-3768874,3768924-3769013,3769014-3771818 Length = 1632 Score = 28.7 bits (61), Expect = 6.0 Identities = 15/31 (48%), Positives = 15/31 (48%), Gaps = 1/31 (3%) Frame = +2 Query: 152 HVPMAEPFAI-QSVCSFVEADPHFCGHRAKN 241 HVPM EP I S C V AD G KN Sbjct: 1336 HVPMQEPLRIASSCCEIVNADQVCAGEVGKN 1366 >03_05_0136 + 21158917-21159939,21160183-21160241,21160259-21160294, 21160345-21160387,21160582-21160698,21162090-21162179, 21162329-21162436,21162547-21162588 Length = 505 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +2 Query: 599 RFYDSGAEDISSSGSDCSTGTRG 667 R D+GA D++SSGS+CS +RG Sbjct: 176 RRLDAGA-DVASSGSECSDASRG 197 >01_01_0092 + 722744-723459,723542-723711,723792-724885 Length = 659 Score = 28.7 bits (61), Expect = 6.0 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 129 VSITDDQFTFPWLNLSPFSLFAPLWKLIPTFVDIGPRIY 245 +S + +F NL S PLW +P F D+G ++Y Sbjct: 92 ISYNESRFWVVDANLDNSSCPLPLWNNLPYFNDMGTKLY 130 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,651,601 Number of Sequences: 37544 Number of extensions: 317608 Number of successful extensions: 1068 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1068 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2291695380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -