BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0331 (830 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g53800.1 68418.m06685 expressed protein 33 0.31 At1g34320.1 68414.m04259 expressed protein contains Pfam domain ... 32 0.54 At5g58300.1 68418.m07298 leucine-rich repeat transmembrane prote... 29 2.9 At3g49800.1 68416.m05445 BSD domain-containing protein contains ... 29 2.9 At2g04900.1 68415.m00509 expressed protein 29 3.8 At1g64550.1 68414.m07317 ABC transporter family protein similar ... 28 6.6 At3g23670.1 68416.m02976 phragmoplast-associated kinesin-related... 28 8.7 At3g11310.1 68416.m01375 hypothetical protein 28 8.7 At3g07090.1 68416.m00843 expressed protein 28 8.7 At1g04140.2 68414.m00404 transducin family protein / WD-40 repea... 28 8.7 At1g04140.1 68414.m00403 transducin family protein / WD-40 repea... 28 8.7 >At5g53800.1 68418.m06685 expressed protein Length = 351 Score = 32.7 bits (71), Expect = 0.31 Identities = 21/64 (32%), Positives = 28/64 (43%) Frame = +2 Query: 572 RKDDSRNLGRFYDSGAEDISSSGSDCSTGTRGEERTDHALRTR*SDRKRQRDPTRKRSFC 751 R++ R DSG+E SGS+ R R D R SDRK R R+R + Sbjct: 47 RRESKRRTKDGNDSGSESGLESGSESEKEERRRSRKDRGKRK--SDRKSSRSRRRRRDYS 104 Query: 752 LSDN 763 S + Sbjct: 105 SSSS 108 >At1g34320.1 68414.m04259 expressed protein contains Pfam domain PF05003: protein of unknown function (DUF668) Length = 657 Score = 31.9 bits (69), Expect = 0.54 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +3 Query: 390 FFHTYSLPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTER--VVPIVETGA 548 F H +N++A+D+ + G +P++ENVD K+T PIV +G+ Sbjct: 19 FAHVNGHHLNNNASDLNSHSGESGLKDDPSPVTENVDDNKHTSESFSFPIVSSGS 73 >At5g58300.1 68418.m07298 leucine-rich repeat transmembrane protein kinase, putative Length = 654 Score = 29.5 bits (63), Expect = 2.9 Identities = 20/67 (29%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Frame = -2 Query: 220 KVGISFHKGANRLN---GERFSHGNVNWSSVMETGCAITSLSRAGKAVTVAKPAKAMKTA 50 K+ +S KG L+ G +FSHGN+ S+V+ + +S G +A P M+ A Sbjct: 461 KITLSAAKGIAHLHAAGGPKFSHGNIKSSNVIMKQESDACISDFGLTPLMAVPIAPMRGA 520 Query: 49 KRRGENI 29 R + Sbjct: 521 GYRAPEV 527 >At3g49800.1 68416.m05445 BSD domain-containing protein contains Pfam profile PF03909: BSD domain Length = 428 Score = 29.5 bits (63), Expect = 2.9 Identities = 26/86 (30%), Positives = 40/86 (46%), Gaps = 3/86 (3%) Frame = +3 Query: 369 HDVFASQFFHTYSLP-VNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIVETG 545 H +F+ T S P V S A ++ EL T + E+ D+ ++E V P+ + Sbjct: 244 HPIFSKHDALTLSTPQVLESRALLSHELLRKRNKD-TVVVPESSDRGADSENVEPLFQPT 302 Query: 546 APYKKDEP--VEKTTVETLDVSTTQE 617 P K EP V+ TVET+ + E Sbjct: 303 NPSPKSEPEPVKTITVETIHSAERSE 328 >At2g04900.1 68415.m00509 expressed protein Length = 128 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/38 (28%), Positives = 24/38 (63%) Frame = -2 Query: 523 TRSVFFVLSTFSLIGAVTTRYPSEVSSAVTSAALEFTG 410 T S++ ++ T +L+ A +T+YP+ +T+ + F+G Sbjct: 58 TASLYHLVHTAALVSAPSTKYPNIFGGLLTAGIVAFSG 95 >At1g64550.1 68414.m07317 ABC transporter family protein similar to ABC transporter protein GB:AAF31030 GI:6899653 from [Leishmania major] Length = 715 Score = 28.3 bits (60), Expect = 6.6 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 4/65 (6%) Frame = +3 Query: 408 LPVNSSAADVTAELTSDGYLVVTAPISENVDKTKNTERVVPIV----ETGAPYKKDEPVE 575 +P N V E+ D + ++ ++++TK E + I+ ET P KD Sbjct: 228 IPTNCQILHVEQEVVGDKTTALQCVLNTDIERTKLLEEEIQILAKQRETEEPTAKDGMPT 287 Query: 576 KTTVE 590 K TVE Sbjct: 288 KDTVE 292 >At3g23670.1 68416.m02976 phragmoplast-associated kinesin-related protein, putative similar to kinesin like protein GB:CAB10194 from [Arabidopsis thaliana] Length = 1313 Score = 27.9 bits (59), Expect = 8.7 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = +2 Query: 575 KDDSRNLGRFYDSGAEDISSSGSDCSTGTRGEERTDHAL 691 KD+S N S A D++ + C T G E TD+AL Sbjct: 555 KDESYNNSHLKSSEATDVNMEDACCQTENNGSE-TDNAL 592 >At3g11310.1 68416.m01375 hypothetical protein Length = 539 Score = 27.9 bits (59), Expect = 8.7 Identities = 17/68 (25%), Positives = 30/68 (44%), Gaps = 7/68 (10%) Frame = +3 Query: 336 VQGSQEAKEDDHDVFASQFFHTYSLPVNSSAADVTAELT-------SDGYLVVTAPISEN 494 V GS+ +DDH + F + P +SS D+ +T D Y+V+ + Sbjct: 339 VPGSEGGADDDHHIVMDHHFESPHDPASSSEIDLNEPVTGSEGGADDDHYIVLNHLVESP 398 Query: 495 VDKTKNTE 518 D+ ++E Sbjct: 399 HDRAPSSE 406 >At3g07090.1 68416.m00843 expressed protein Length = 265 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +3 Query: 456 DGYLVVTAPISENVDKTKNTERVVPIVETGAPYK--KDEPV 572 DG +V AP E + + TE+V P+++ A + KD+P+ Sbjct: 177 DGPQIVIAPKLEAAETSTATEKVPPVIQPSASKEKVKDDPL 217 >At1g04140.2 68414.m00404 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 793 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -2 Query: 475 VTTRYPSEVSSAVTSAALEFTGRL*VWKN 389 V R PSE++S++ +A L T +L VW + Sbjct: 536 VVNRIPSELASSIAAAELPCTVKLRVWSH 564 >At1g04140.1 68414.m00403 transducin family protein / WD-40 repeat family protein contains 4 WD-40 repeats (PF00400); similar to neural cell adhesion molecule 2, large isoform precursor gb|M76710 from Xenopus laevis, and beta transducin from S. cerevisiae gb|Q05946. ESTs gb|N65081 gb|Z30910, gb|Z34190, gb|Z34611, gb|R30101, gb|H36304, and gb|N65606 come from Length = 790 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = -2 Query: 475 VTTRYPSEVSSAVTSAALEFTGRL*VWKN 389 V R PSE++S++ +A L T +L VW + Sbjct: 536 VVNRIPSELASSIAAAELPCTVKLRVWSH 564 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,310,072 Number of Sequences: 28952 Number of extensions: 255038 Number of successful extensions: 819 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 802 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 819 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1911862400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -