Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0330
         (618 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ103706-1|AAZ43087.1|  344|Anopheles gambiae pk-1 receptor prot...    25   1.5  
AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific tran...    23   6.0  

>DQ103706-1|AAZ43087.1|  344|Anopheles gambiae pk-1 receptor
           protein.
          Length = 344

 Score = 25.4 bits (53), Expect = 1.5
 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 4/69 (5%)
 Frame = -1

Query: 279 EPVFIIIALS----LSIVTSLYYNFFIPCHCQIKNRLLNVSVTRFASFFLVFVKILIISS 112
           +P++++I ++    L  +T +  N    C    +NR ++ + T +  F L     L++ S
Sbjct: 40  DPLYVVIPITIIYLLIFITGVVGNIST-CIVIARNRSMHTA-TNYYLFSLAVSDFLLLVS 97

Query: 111 VSPDEFYFV 85
             P E YF+
Sbjct: 98  GVPQEIYFI 106


>AY785361-1|AAV52865.1|  960|Anopheles gambiae male-specific
           transcription factor FRU-MA protein.
          Length = 960

 Score = 23.4 bits (48), Expect = 6.0
 Identities = 7/8 (87%), Positives = 8/8 (100%)
 Frame = -3

Query: 283 HRAGVHHH 260
           HRAG+HHH
Sbjct: 495 HRAGLHHH 502


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 583,212
Number of Sequences: 2352
Number of extensions: 11141
Number of successful extensions: 11
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 563,979
effective HSP length: 61
effective length of database: 420,507
effective search space used: 60553008
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)