BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0330 (618 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 25 1.5 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 23 6.0 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 25.4 bits (53), Expect = 1.5 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = -1 Query: 279 EPVFIIIALS----LSIVTSLYYNFFIPCHCQIKNRLLNVSVTRFASFFLVFVKILIISS 112 +P++++I ++ L +T + N C +NR ++ + T + F L L++ S Sbjct: 40 DPLYVVIPITIIYLLIFITGVVGNIST-CIVIARNRSMHTA-TNYYLFSLAVSDFLLLVS 97 Query: 111 VSPDEFYFV 85 P E YF+ Sbjct: 98 GVPQEIYFI 106 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 23.4 bits (48), Expect = 6.0 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -3 Query: 283 HRAGVHHH 260 HRAG+HHH Sbjct: 495 HRAGLHHH 502 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 583,212 Number of Sequences: 2352 Number of extensions: 11141 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -