BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0329 (780 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0122 + 1495426-1495815 30 1.8 03_04_0010 + 16364037-16364046,16364769-16364858,16366018-163661... 29 3.1 >10_01_0122 + 1495426-1495815 Length = 129 Score = 30.3 bits (65), Expect = 1.8 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 1 FFFFFFIAQMSGRAHSPPGVKWLLEPIDIYNVN 99 FFFFFF +SG + G + L+P+ +Y V+ Sbjct: 15 FFFFFFFFFLSGCLRAGAGDRGALDPVLLYGVD 47 >03_04_0010 + 16364037-16364046,16364769-16364858,16366018-16366151, 16367092-16367250,16368191-16368292 Length = 164 Score = 29.5 bits (63), Expect = 3.1 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -1 Query: 159 WGSRCSCTEILELISQGGW 103 W + C C +I EL++ GGW Sbjct: 128 WRTMCGCKDIKELLAVGGW 146 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,860,426 Number of Sequences: 37544 Number of extensions: 294387 Number of successful extensions: 494 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 482 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 494 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2091906552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -