BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0328 (742 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 23 3.4 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 23 3.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 3.4 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 3.4 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 22 4.5 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 22 4.5 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 22.6 bits (46), Expect = 3.4 Identities = 15/61 (24%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = -3 Query: 527 EMVQKYQNIFFKNFTQCR**VLKWALS*SDQKYYQI*TKVLF--YYISL---DQETHHNQ 363 EM++ +++F + QC +++ L YY++ T + F +I D + H N+ Sbjct: 1 EMMEFLKSVFRLDQDQCSHRIVREHLGLKHDNYYELETHIFFDDAFIRTSEDDNDPHVNE 60 Query: 362 Y 360 Y Sbjct: 61 Y 61 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 22.6 bits (46), Expect = 3.4 Identities = 15/61 (24%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = -3 Query: 527 EMVQKYQNIFFKNFTQCR**VLKWALS*SDQKYYQI*TKVLF--YYISL---DQETHHNQ 363 EM++ +++F + QC +++ L YY++ T + F +I D + H N+ Sbjct: 315 EMMEFLKSVFRLDQDQCSHRIVREHLGLKHDNYYELETHIFFDDAFIRTSEDDNDPHVNE 374 Query: 362 Y 360 Y Sbjct: 375 Y 375 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.4 Identities = 15/61 (24%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = -3 Query: 527 EMVQKYQNIFFKNFTQCR**VLKWALS*SDQKYYQI*TKVLF--YYISL---DQETHHNQ 363 EM++ +++F + QC +++ L YY++ T + F +I D + H N+ Sbjct: 548 EMMEFLKSVFRLDQDQCSHRIVREHLGLKHDNYYELETHIFFDDAFIRTSEDDNDPHVNE 607 Query: 362 Y 360 Y Sbjct: 608 Y 608 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.4 Identities = 15/61 (24%), Positives = 30/61 (49%), Gaps = 5/61 (8%) Frame = -3 Query: 527 EMVQKYQNIFFKNFTQCR**VLKWALS*SDQKYYQI*TKVLF--YYISL---DQETHHNQ 363 EM++ +++F + QC +++ L YY++ T + F +I D + H N+ Sbjct: 548 EMMEFLKSVFRLDQDQCSHRIVREHLGLKHDNYYELETHIFFDDAFIRTSEDDNDPHVNE 607 Query: 362 Y 360 Y Sbjct: 608 Y 608 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 22.2 bits (45), Expect = 4.5 Identities = 9/21 (42%), Positives = 14/21 (66%) Frame = -1 Query: 64 LSLVFKVNSALLFLTFPVSLL 2 L VF + S L+F FP+++L Sbjct: 233 LPCVFFLGSILIFFIFPLAIL 253 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 22.2 bits (45), Expect = 4.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 120 IPASTTKSLISSPTPNH 170 +P T SSPTP+H Sbjct: 191 LPTPTCSEASSSPTPSH 207 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,802 Number of Sequences: 336 Number of extensions: 3593 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -