BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0328 (742 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) 56 4e-08 SB_7972| Best HMM Match : RVT_1 (HMM E-Value=5.8e-29) 56 4e-08 SB_11851| Best HMM Match : IncFII_repA (HMM E-Value=1.4) 56 4e-08 SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 4e-08 SB_59519| Best HMM Match : RVT_1 (HMM E-Value=3.5e-11) 54 1e-07 SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) 54 1e-07 SB_38898| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 54 1e-07 SB_32540| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 54 1e-07 SB_30213| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) 54 1e-07 SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) 54 1e-07 SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) 54 1e-07 SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) 54 1e-07 SB_33122| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 54 1e-07 SB_23765| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 1e-07 SB_14369| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) 54 1e-07 SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) 54 1e-07 SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07) 54 1e-07 SB_4524| Best HMM Match : Ribosomal_S7e (HMM E-Value=0.59) 54 1e-07 SB_3348| Best HMM Match : Borrelia_orfA (HMM E-Value=0.71) 54 1e-07 SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) 54 2e-07 SB_39791| Best HMM Match : RVT_1 (HMM E-Value=0.083) 54 2e-07 SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) 53 2e-07 SB_23576| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 2e-07 SB_6009| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) 53 3e-07 SB_13949| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 6e-07 SB_38467| Best HMM Match : RVT_1 (HMM E-Value=4.2e-05) 52 6e-07 SB_10046| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_34368| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_43683| Best HMM Match : RVT_1 (HMM E-Value=0.024) 50 2e-06 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 48 6e-06 SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12) 48 1e-05 SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) 48 1e-05 SB_22068| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_12012| Best HMM Match : DUF327 (HMM E-Value=2) 48 1e-05 SB_798| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 1e-05 SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44) 48 1e-05 SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) 48 1e-05 SB_30907| Best HMM Match : THAP (HMM E-Value=0.0033) 47 1e-05 SB_15184| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_9604| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) 47 1e-05 SB_796| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_17488| Best HMM Match : Phi-29_GP3 (HMM E-Value=0.69) 47 1e-05 SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) 47 1e-05 SB_4171| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) 47 1e-05 SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 47 2e-05 SB_35000| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_799| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_10470| Best HMM Match : Herpes_UL33 (HMM E-Value=1.8) 46 3e-05 SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) 46 4e-05 SB_36163| Best HMM Match : RVT_1 (HMM E-Value=4.2e-11) 46 4e-05 SB_50373| Best HMM Match : HC2 (HMM E-Value=0.001) 45 6e-05 SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) 45 6e-05 SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) 45 6e-05 SB_36459| Best HMM Match : FlgN (HMM E-Value=2.2) 45 6e-05 SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) 45 6e-05 SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) 45 6e-05 SB_9596| Best HMM Match : BAF (HMM E-Value=1.54143e-44) 45 6e-05 SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 6e-05 SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) 45 6e-05 SB_53688| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_48302| Best HMM Match : HORMA (HMM E-Value=1.1) 45 7e-05 SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) 45 7e-05 SB_17727| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) 45 7e-05 SB_1875| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_58397| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_57813| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_54849| Best HMM Match : HORMA (HMM E-Value=0.54) 45 7e-05 SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_13020| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 7e-05 SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) 45 7e-05 SB_48808| Best HMM Match : DEAD (HMM E-Value=0.029) 44 1e-04 SB_20189| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3992| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) 44 1e-04 SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) 44 1e-04 SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) 44 1e-04 SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_50273| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_37633| Best HMM Match : DUF327 (HMM E-Value=2.1) 44 1e-04 SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) 44 1e-04 SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) 44 1e-04 SB_24579| Best HMM Match : rve (HMM E-Value=0.085) 44 1e-04 SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_38561| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4) 44 2e-04 SB_12038| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 2e-04 SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08) 43 2e-04 SB_21018| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_58944| Best HMM Match : fn3 (HMM E-Value=0.88) 43 2e-04 SB_45202| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_27420| Best HMM Match : PHB_acc (HMM E-Value=6.6) 43 3e-04 SB_56575| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_20001| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 3e-04 SB_27488| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_32111| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_21205| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.75) 42 5e-04 SB_47673| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) 42 5e-04 SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_10854| Best HMM Match : Hormone_4 (HMM E-Value=8.4) 42 7e-04 SB_48125| Best HMM Match : RVT_1 (HMM E-Value=8.4e-38) 42 7e-04 SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32) 42 7e-04 SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 7e-04 SB_2306| Best HMM Match : MecA_N (HMM E-Value=2.3) 42 7e-04 SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) 41 0.001 SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) 41 0.001 SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) 41 0.001 SB_12448| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 0.001 SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) 41 0.001 SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2) 41 0.001 SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_32796| Best HMM Match : MSG (HMM E-Value=2.7) 40 0.002 SB_29231| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 40 0.002 SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023) 40 0.002 SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 40 0.002 SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) 40 0.002 SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031) 40 0.002 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) 40 0.002 SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011) 40 0.002 SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37) 40 0.002 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.002 SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) 40 0.003 SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) 40 0.003 SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.003 SB_40881| Best HMM Match : RVT_1 (HMM E-Value=2.9e-21) 40 0.003 SB_39766| Best HMM Match : RVT_1 (HMM E-Value=1.8e-07) 40 0.003 SB_39386| Best HMM Match : RVT_1 (HMM E-Value=7.1e-28) 40 0.003 SB_35561| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00092) 40 0.003 SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) 40 0.003 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 40 0.003 SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 40 0.003 SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) 40 0.003 SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) 40 0.003 SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_42168| Best HMM Match : NolV (HMM E-Value=7.1) 40 0.003 SB_31839| Best HMM Match : Exo_endo_phos (HMM E-Value=1.3e-11) 40 0.003 SB_27891| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.003 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 40 0.003 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 40 0.003 SB_6960| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 40 0.003 SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) 40 0.003 SB_10707| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.004 SB_59377| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7) 39 0.005 SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) 39 0.005 SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_38578| Best HMM Match : RVT_1 (HMM E-Value=0.018) 39 0.005 SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.005 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 39 0.005 SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) 39 0.005 SB_20796| Best HMM Match : RVT_1 (HMM E-Value=0.047) 39 0.005 SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) 39 0.005 SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_10154| Best HMM Match : RVT_1 (HMM E-Value=4.3e-17) 39 0.005 SB_6691| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0031) 39 0.005 SB_53821| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_24580| Best HMM Match : zf-C2H2 (HMM E-Value=0) 38 0.006 SB_50409| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30) 38 0.009 SB_51839| Best HMM Match : Gp-FAR-1 (HMM E-Value=2) 38 0.009 SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 38 0.009 SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26855| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.009 SB_25574| Best HMM Match : Gp-FAR-1 (HMM E-Value=1.9) 38 0.009 SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) 38 0.009 SB_23472| Best HMM Match : HIT (HMM E-Value=0.43) 38 0.009 SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) 38 0.009 SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) 38 0.009 SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.009 SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18) 38 0.009 SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) 38 0.009 SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) 38 0.009 SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_42505| Best HMM Match : RVT_1 (HMM E-Value=3.9e-18) 38 0.009 SB_41541| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17) 38 0.009 SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) 38 0.009 SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) 38 0.009 SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) 38 0.009 SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 38 0.009 SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) 38 0.009 SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.009 SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.009 SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) 38 0.009 SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.011 SB_55916| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_44316| Best HMM Match : Exo_endo_phos (HMM E-Value=0.14) 38 0.011 SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085) 38 0.011 SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) 38 0.011 SB_21517| Best HMM Match : UCR_UQCRX_QCR9 (HMM E-Value=7.2) 38 0.011 SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) 38 0.011 SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) 38 0.011 SB_37732| Best HMM Match : RVT_1 (HMM E-Value=2e-23) 38 0.011 SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_20167| Best HMM Match : RhoGEF (HMM E-Value=0.73) 38 0.011 SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) 38 0.011 SB_9018| Best HMM Match : NolV (HMM E-Value=2.7) 38 0.011 SB_3901| Best HMM Match : PkinA_anch (HMM E-Value=2.4) 38 0.011 SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) 37 0.015 SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) 37 0.015 SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) 37 0.015 SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) 37 0.015 SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) 37 0.015 SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) 37 0.015 SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) 37 0.015 SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) 37 0.015 SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) 37 0.015 SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) 37 0.015 SB_48371| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) 37 0.015 SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) 37 0.015 SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) 37 0.015 SB_28146| Best HMM Match : Na_Ca_ex (HMM E-Value=0.039) 37 0.015 SB_24847| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.015 SB_4888| Best HMM Match : DUF104 (HMM E-Value=7.3) 37 0.015 SB_50861| Best HMM Match : Borrelia_orfA (HMM E-Value=4.4) 37 0.020 SB_38793| Best HMM Match : RepA_N (HMM E-Value=3.4) 37 0.020 SB_11125| Best HMM Match : Borrelia_orfA (HMM E-Value=2.7) 37 0.020 SB_7753| Best HMM Match : RVT_1 (HMM E-Value=0.089) 37 0.020 SB_54393| Best HMM Match : RNA_pol_Rpc34 (HMM E-Value=9.3e-10) 37 0.020 SB_28047| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.020 SB_25508| Best HMM Match : RVT_1 (HMM E-Value=6e-14) 37 0.020 SB_11864| Best HMM Match : RVT_1 (HMM E-Value=0.012) 37 0.020 SB_3017| Best HMM Match : RVT_1 (HMM E-Value=1.1e-19) 37 0.020 SB_42093| Best HMM Match : RVT_1 (HMM E-Value=2.5e-20) 36 0.026 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_38350| Best HMM Match : OCIA (HMM E-Value=6.7) 36 0.026 SB_28572| Best HMM Match : RVT_1 (HMM E-Value=2e-20) 36 0.026 SB_4188| Best HMM Match : 7tm_1 (HMM E-Value=9e-06) 36 0.026 SB_2508| Best HMM Match : RVT_1 (HMM E-Value=1e-05) 36 0.026 SB_1758| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.026 SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.026 SB_53096| Best HMM Match : PHD (HMM E-Value=0.001) 36 0.026 SB_41708| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_29864| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_24162| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.026 SB_12628| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_10781| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.026 SB_7055| Best HMM Match : RVT_1 (HMM E-Value=0.00051) 36 0.026 SB_6740| Best HMM Match : RVT_1 (HMM E-Value=4.5e-22) 36 0.026 SB_3080| Best HMM Match : Methylase_S (HMM E-Value=2.6) 36 0.026 SB_49526| Best HMM Match : HSBP1 (HMM E-Value=0.28) 36 0.034 SB_47691| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_34112| Best HMM Match : RVT_1 (HMM E-Value=0.041) 36 0.034 SB_31593| Best HMM Match : Ribonuclease_3 (HMM E-Value=6.30024e-42) 36 0.034 SB_30812| Best HMM Match : RVT_1 (HMM E-Value=1.2e-40) 36 0.034 SB_30053| Best HMM Match : RVT_1 (HMM E-Value=2.3e-24) 36 0.034 SB_21844| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.034 SB_11753| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.034 SB_4543| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_58606| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_58227| Best HMM Match : HSBP1 (HMM E-Value=0.28) 36 0.034 SB_57858| Best HMM Match : RNA_pol_A_CTD (HMM E-Value=5.7) 36 0.034 SB_54068| Best HMM Match : RVT_1 (HMM E-Value=0.92) 36 0.034 SB_24534| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.034 SB_24072| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_20359| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.034 SB_19795| Best HMM Match : RVT_1 (HMM E-Value=1.3) 36 0.034 SB_19684| Best HMM Match : RVT_1 (HMM E-Value=0) 36 0.034 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 36 0.034 SB_49549| Best HMM Match : RVT_1 (HMM E-Value=3.6e-11) 36 0.046 SB_45791| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.2) 36 0.046 SB_35875| Best HMM Match : RVT_1 (HMM E-Value=5.2e-24) 36 0.046 SB_35814| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_35551| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_34832| Best HMM Match : SAP (HMM E-Value=1.4e-07) 36 0.046 SB_30009| Best HMM Match : RVT_1 (HMM E-Value=1.2e-18) 36 0.046 SB_9950| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_52988| Best HMM Match : RVT_1 (HMM E-Value=2.5) 36 0.046 SB_52566| Best HMM Match : Baculo_FP (HMM E-Value=1.7) 36 0.046 SB_36141| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_33259| Best HMM Match : RVT_1 (HMM E-Value=4.3e-12) 36 0.046 SB_24694| Best HMM Match : RVT_1 (HMM E-Value=0.99) 36 0.046 SB_9841| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_58209| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.060 SB_32049| Best HMM Match : RVT_1 (HMM E-Value=6.7e-15) 35 0.060 SB_31382| Best HMM Match : RVT_1 (HMM E-Value=2.2e-12) 35 0.060 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 35 0.060 SB_3609| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.060 SB_29966| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.060 SB_22732| Best HMM Match : RVT_1 (HMM E-Value=2.2e-23) 35 0.060 SB_58923| Best HMM Match : RVT_1 (HMM E-Value=0.022) 35 0.080 SB_57968| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_45315| Best HMM Match : DUF1235 (HMM E-Value=2.3) 35 0.080 SB_43156| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_40446| Best HMM Match : RVT_1 (HMM E-Value=2.2e-16) 35 0.080 SB_32197| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_25338| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_19845| Best HMM Match : Macscav_rec (HMM E-Value=9.9) 35 0.080 SB_452| Best HMM Match : RVT_1 (HMM E-Value=9.9e-25) 35 0.080 SB_55401| Best HMM Match : Flp_N (HMM E-Value=9.2) 35 0.080 SB_55395| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_45340| Best HMM Match : RVT_1 (HMM E-Value=1.2e-15) 35 0.080 SB_29292| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_27764| Best HMM Match : RVT_1 (HMM E-Value=3.99931e-42) 35 0.080 SB_26022| Best HMM Match : DUF1235 (HMM E-Value=4.8) 35 0.080 SB_24630| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_19398| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_18605| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_16607| Best HMM Match : Flp_N (HMM E-Value=9.2) 35 0.080 SB_12041| Best HMM Match : PHD (HMM E-Value=0.001) 35 0.080 SB_8907| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_950| Best HMM Match : Flp_N (HMM E-Value=1.7) 35 0.080 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_42059| Best HMM Match : RVT_1 (HMM E-Value=0.0011) 34 0.11 SB_41513| Best HMM Match : RVT_1 (HMM E-Value=8.9e-21) 34 0.11 SB_33113| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_27128| Best HMM Match : PADR1 (HMM E-Value=8.3) 34 0.11 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_7615| Best HMM Match : RVT_1 (HMM E-Value=1e-33) 34 0.11 SB_47504| Best HMM Match : RVT_1 (HMM E-Value=1.4e-07) 34 0.11 SB_38372| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.11 SB_37776| Best HMM Match : fn3 (HMM E-Value=1.4e-22) 34 0.11 SB_31162| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_30264| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_28404| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_20057| Best HMM Match : RVT_1 (HMM E-Value=3e-13) 34 0.11 SB_10275| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_1851| Best HMM Match : RVT_1 (HMM E-Value=3.2e-16) 34 0.11 SB_48736| Best HMM Match : RVT_1 (HMM E-Value=1.4e-11) 34 0.14 SB_47354| Best HMM Match : RVT_1 (HMM E-Value=2e-07) 34 0.14 SB_45345| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_41296| Best HMM Match : RVT_1 (HMM E-Value=2.8e-24) 34 0.14 SB_22943| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_21074| Best HMM Match : NadA (HMM E-Value=2) 34 0.14 SB_18090| Best HMM Match : RVT_1 (HMM E-Value=0.59) 34 0.14 SB_15993| Best HMM Match : RVT_1 (HMM E-Value=7.2e-12) 34 0.14 SB_13911| Best HMM Match : PAN (HMM E-Value=0.033) 34 0.14 SB_12964| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 34 0.14 SB_8311| Best HMM Match : RVT_1 (HMM E-Value=3.9e-29) 34 0.14 SB_4338| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_58114| Best HMM Match : DUF1478 (HMM E-Value=3) 34 0.14 SB_55599| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 34 0.14 SB_47851| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_46439| Best HMM Match : RVT_1 (HMM E-Value=4.8e-25) 34 0.14 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 34 0.14 SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_33858| Best HMM Match : RVT_1 (HMM E-Value=3.7e-21) 34 0.14 SB_32319| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_31930| Best HMM Match : RVT_1 (HMM E-Value=1.3e-33) 34 0.14 SB_28157| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_26363| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_26322| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_25560| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_21388| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_19280| Best HMM Match : RVT_1 (HMM E-Value=3.5e-12) 34 0.14 SB_18722| Best HMM Match : RVT_1 (HMM E-Value=2.8e-08) 34 0.14 SB_18097| Best HMM Match : NadA (HMM E-Value=2.2) 34 0.14 SB_17856| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_16275| Best HMM Match : RVT_1 (HMM E-Value=1.7e-16) 34 0.14 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 34 0.14 SB_11516| Best HMM Match : Lectin_C (HMM E-Value=2.9) 34 0.14 SB_6463| Best HMM Match : RVT_1 (HMM E-Value=2.2e-13) 34 0.14 SB_2999| Best HMM Match : RVT_1 (HMM E-Value=5.6e-31) 34 0.14 SB_2489| Best HMM Match : RVT_1 (HMM E-Value=0.02) 34 0.14 SB_2458| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_45963| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_35790| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_35764| Best HMM Match : RVT_1 (HMM E-Value=8.1e-13) 33 0.18 SB_35414| Best HMM Match : NinE (HMM E-Value=8.4) 33 0.18 SB_26857| Best HMM Match : Viral_NABP (HMM E-Value=2.6) 33 0.18 SB_21602| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_15188| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_15009| Best HMM Match : TP2 (HMM E-Value=3.3) 33 0.18 SB_9500| Best HMM Match : Saccharop_dh_N (HMM E-Value=1.8) 33 0.18 SB_5816| Best HMM Match : RVT_1 (HMM E-Value=3e-16) 33 0.18 SB_5231| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_59736| Best HMM Match : RVT_1 (HMM E-Value=8.2e-31) 33 0.18 SB_59564| Best HMM Match : Vicilin_N (HMM E-Value=4.8) 33 0.18 SB_58486| Best HMM Match : Vicilin_N (HMM E-Value=1.6) 33 0.18 SB_56177| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_55189| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_53833| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_51811| Best HMM Match : Vicilin_N (HMM E-Value=1.9) 33 0.18 SB_51050| Best HMM Match : DUF1168 (HMM E-Value=1) 33 0.18 SB_47186| Best HMM Match : Vicilin_N (HMM E-Value=5.3) 33 0.18 SB_42770| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) 33 0.18 SB_38460| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_37537| Best HMM Match : Vicilin_N (HMM E-Value=1) 33 0.18 SB_37315| Best HMM Match : DUF1565 (HMM E-Value=5.2) 33 0.18 SB_32390| Best HMM Match : Vicilin_N (HMM E-Value=0.3) 33 0.18 SB_18340| Best HMM Match : Vicilin_N (HMM E-Value=1.5) 33 0.18 SB_16993| Best HMM Match : RVT_1 (HMM E-Value=0.35) 33 0.18 SB_16475| Best HMM Match : Vicilin_N (HMM E-Value=1.6) 33 0.18 SB_12419| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_7284| Best HMM Match : F5_F8_type_C (HMM E-Value=7.3e-10) 33 0.18 SB_3024| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_17390| Best HMM Match : Exo_endo_phos (HMM E-Value=3.1e-13) 33 0.24 SB_15522| Best HMM Match : DUF590 (HMM E-Value=5.8) 33 0.24 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 33 0.24 SB_56874| Best HMM Match : RVT_1 (HMM E-Value=4.5e-38) 33 0.24 SB_50062| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_48535| Best HMM Match : DUF412 (HMM E-Value=3.5) 33 0.24 SB_41989| Best HMM Match : RVT_1 (HMM E-Value=1.2e-33) 33 0.24 SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_39518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_15469| Best HMM Match : RVT_1 (HMM E-Value=0.00014) 33 0.24 SB_5957| Best HMM Match : Chitin_synth_1 (HMM E-Value=9) 33 0.24 SB_52970| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_50612| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 33 0.32 SB_48543| Best HMM Match : Exo_endo_phos (HMM E-Value=7.8e-06) 33 0.32 SB_39367| Best HMM Match : RVT_1 (HMM E-Value=2.3e-26) 33 0.32 SB_30911| Best HMM Match : TT_ORF2 (HMM E-Value=1.1) 33 0.32 SB_27204| Best HMM Match : RVT_1 (HMM E-Value=0.00085) 33 0.32 SB_23604| Best HMM Match : RVT_1 (HMM E-Value=4.6e-13) 33 0.32 SB_10873| Best HMM Match : Exo_endo_phos (HMM E-Value=0.068) 33 0.32 SB_907| Best HMM Match : RVT_1 (HMM E-Value=1.3e-27) 33 0.32 SB_54400| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_41175| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_14103| Best HMM Match : RVT_1 (HMM E-Value=0.023) 33 0.32 SB_36808| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_24508| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_20736| Best HMM Match : DUF1628 (HMM E-Value=9.4) 32 0.42 SB_58999| Best HMM Match : Exo_endo_phos (HMM E-Value=2.6) 32 0.42 SB_58520| Best HMM Match : RVT_1 (HMM E-Value=0.035) 32 0.42 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_43942| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_14635| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.42 SB_59586| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_58198| Best HMM Match : Exo_endo_phos (HMM E-Value=0.012) 32 0.56 SB_37794| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_35248| Best HMM Match : DUF999 (HMM E-Value=2.7) 32 0.56 SB_34933| Best HMM Match : RVT_1 (HMM E-Value=3.5e-08) 32 0.56 SB_31085| Best HMM Match : RVT_1 (HMM E-Value=0.0094) 32 0.56 SB_12730| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_57531| Best HMM Match : RVT_1 (HMM E-Value=2.9e-10) 32 0.56 SB_55944| Best HMM Match : RVT_1 (HMM E-Value=1.6e-11) 32 0.56 SB_52619| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_45694| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_43228| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 32 0.56 SB_38694| Best HMM Match : RVT_1 (HMM E-Value=3.8e-09) 32 0.56 SB_34652| Best HMM Match : Ank (HMM E-Value=3.8e-34) 32 0.56 SB_11213| Best HMM Match : RVT_1 (HMM E-Value=6.4e-38) 32 0.56 SB_2811| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_2303| Best HMM Match : RVT_1 (HMM E-Value=7.9e-11) 32 0.56 SB_54431| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_46891| Best HMM Match : RVT_1 (HMM E-Value=1.6e-05) 31 0.74 SB_45447| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_40349| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_35568| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_33669| Best HMM Match : EMP70 (HMM E-Value=3.9e-11) 31 0.74 SB_33535| Best HMM Match : RVT_1 (HMM E-Value=1.4013e-45) 31 0.74 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 31 0.74 SB_22818| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_54198| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_54054| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_41460| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_31451| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_22738| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.74 SB_7440| Best HMM Match : fn3 (HMM E-Value=0.35) 31 0.74 SB_48268| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_38423| Best HMM Match : RVT_1 (HMM E-Value=7.4e-27) 31 0.98 SB_35755| Best HMM Match : RVT_1 (HMM E-Value=1.90001e-40) 31 0.98 SB_11573| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 SB_11322| Best HMM Match : Pkinase_C (HMM E-Value=4.1) 31 0.98 SB_96| Best HMM Match : RVT_1 (HMM E-Value=0.00075) 31 0.98 SB_57527| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.98 >SB_23680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 55.6 bits (128), Expect = 4e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A E + G+F DLSKAFD V+H+ LLRKL HYGIRG+ Sbjct: 142 VDKIQKAIELGQFSCGLFLDLSKAFDTVDHSILLRKLEHYGIRGI 186 Score = 48.4 bits (110), Expect = 6e-06 Identities = 21/43 (48%), Positives = 29/43 (67%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 LA ++N I+ G+ PD K +K+IP+FK GS SN RPIS+ Sbjct: 53 LAMLYNFSIESGIVPDKFKIAKVIPVFKKGSALTLSNYRPISL 95 >SB_14797| Best HMM Match : RVT_1 (HMM E-Value=7.9e-33) Length = 252 Score = 55.6 bits (128), Expect = 4e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A E + G+F DLSKAFD V+H+ LLRKL HYGIRG+ Sbjct: 88 VDKIQKAIELGQFSCGLFLDLSKAFDTVDHSILLRKLEHYGIRGI 132 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/40 (47%), Positives = 27/40 (67%) Frame = +2 Query: 347 IFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 ++N I+ G+ PD K +K+IP+FK GS SN RPIS+ Sbjct: 2 LYNFSIESGIVPDKFKIAKVIPVFKKGSALTLSNYRPISL 41 >SB_7972| Best HMM Match : RVT_1 (HMM E-Value=5.8e-29) Length = 382 Score = 55.6 bits (128), Expect = 4e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A E + G+F DLSKAFD V+H+ LLRKL HYGIRG+ Sbjct: 222 VDKIQKAIELGQFSCGLFLDLSKAFDTVDHSILLRKLEHYGIRGI 266 Score = 45.2 bits (102), Expect = 6e-05 Identities = 20/43 (46%), Positives = 28/43 (65%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 LA ++N I+ G+ PD K +K+IP+FK GS SN R IS+ Sbjct: 133 LAMLYNFSIESGIVPDKFKIAKVIPVFKKGSALTLSNYRSISL 175 >SB_11851| Best HMM Match : IncFII_repA (HMM E-Value=1.4) Length = 401 Score = 55.6 bits (128), Expect = 4e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A E + G+F DLSKAFD V+H+ LLRKL HYGIRG+ Sbjct: 299 VDKIQKAIELGQFSCGLFLDLSKAFDTVDHSILLRKLEHYGIRGI 343 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/43 (48%), Positives = 29/43 (67%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 LA ++ I+ G+ PD K +K+IP+FK GS F SN RPIS+ Sbjct: 210 LAMLYYFSIESGIVPDKFKIAKVIPVFKKGSAFTLSNYRPISL 252 >SB_8080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 273 Score = 55.6 bits (128), Expect = 4e-08 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A E + G+F DLSKAFD V+H+ LLRKL HYGIRG+ Sbjct: 88 VDKIQKAIELGQFSCGLFLDLSKAFDTVDHSILLRKLEHYGIRGI 132 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/40 (47%), Positives = 27/40 (67%) Frame = +2 Query: 347 IFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 ++N I+ G+ PD K +K+IP+FK GS SN RPIS+ Sbjct: 2 LYNFSIESGIVPDKFKIAKVIPVFKKGSALTLSNYRPISL 41 >SB_59519| Best HMM Match : RVT_1 (HMM E-Value=3.5e-11) Length = 214 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 36 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 80 >SB_39089| Best HMM Match : RVT_1 (HMM E-Value=2.2e-20) Length = 396 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 56 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 100 >SB_38898| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 56 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 100 >SB_32540| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 56 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 100 >SB_30213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 56 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 100 >SB_22988| Best HMM Match : RVT_1 (HMM E-Value=5.70328e-43) Length = 1029 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 770 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 814 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L ++N G PD K +K IP+ K S N RPIS+ Sbjct: 681 LEILYNHSFSNGCVPDQFKIAKTIPIHKKDSASCMDNYRPISL 723 >SB_21614| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-41) Length = 1047 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 869 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 913 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L ++N G PD K +K IP+ K S N RPIS+ Sbjct: 780 LEILYNHSFSNGCVPDQFKIAKTIPIHKKDSASCMDNYRPISL 822 >SB_1476| Best HMM Match : RVT_1 (HMM E-Value=5.49309e-43) Length = 1078 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 523 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 567 Score = 31.1 bits (67), Expect = 0.98 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L ++N G PD K +K P+ K S N RPIS+ Sbjct: 434 LEILYNHSFSNGCVPDQFKIAKTFPIHKKDSASCMDNYRPISL 476 >SB_48325| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 872 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 719 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 763 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L ++N G PD K +K IP+ K S N RPIS+ Sbjct: 630 LEILYNHSFSNGCVPDQFKIAKTIPIHKKDSASCMDNYRPISL 672 >SB_34884| Best HMM Match : RVT_1 (HMM E-Value=8.1e-25) Length = 439 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 56 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 100 >SB_33122| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 56 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 100 >SB_23765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 515 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 56 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 100 >SB_14369| Best HMM Match : RVT_1 (HMM E-Value=4.6e-21) Length = 234 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 56 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 100 >SB_10116| Best HMM Match : RVT_1 (HMM E-Value=2.5e-33) Length = 759 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 595 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 639 Score = 28.7 bits (61), Expect = 5.2 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L ++N G PD K + IP+ K S N RPIS+ Sbjct: 506 LEILYNHSFSNGCVPDQFKIAITIPIHKKDSFSCMDNYRPISL 548 >SB_8360| Best HMM Match : RVT_1 (HMM E-Value=3.6e-07) Length = 468 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 325 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 369 Score = 33.5 bits (73), Expect = 0.18 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L ++N G PD +K +K IP+ K S N RPIS+ Sbjct: 236 LEILYNHSFSNGCVPDQLKIAKTIPIHKKDSASCMDNYRPISL 278 >SB_4524| Best HMM Match : Ribosomal_S7e (HMM E-Value=0.59) Length = 367 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 288 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 332 Score = 31.1 bits (67), Expect = 0.98 Identities = 16/43 (37%), Positives = 20/43 (46%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L + N G PD K +K IP+ K S N RPIS+ Sbjct: 199 LEILHNHSFSNGCVPDQFKIAKTIPIHKKDSASCMDNYRPISL 241 >SB_3348| Best HMM Match : Borrelia_orfA (HMM E-Value=0.71) Length = 500 Score = 54.0 bits (124), Expect = 1e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 421 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 465 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L ++N G PD K +K IP+ K S N RPIS+ Sbjct: 332 LEILYNHSFSNGCVPDQFKIAKTIPIHKKDSASCMDNYRPISL 374 >SB_39979| Best HMM Match : RVT_1 (HMM E-Value=4.6e-12) Length = 792 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +1 Query: 616 ISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 I +A E + G+F DLSK+FD V+H+ LLRKL HYGIRG+ Sbjct: 325 IQKAIELGQFSCGLFLDLSKSFDTVDHSILLRKLEHYGIRGI 366 >SB_39791| Best HMM Match : RVT_1 (HMM E-Value=0.083) Length = 497 Score = 53.6 bits (123), Expect = 2e-07 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = +1 Query: 622 QAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 +A E + G+F DLSKAFD V+H+ LLRKL HYGIRG+ Sbjct: 221 EAIELGQFSCGLFIDLSKAFDTVDHSILLRKLEHYGIRGI 260 >SB_10952| Best HMM Match : Exo_endo_phos (HMM E-Value=4.1e-08) Length = 558 Score = 53.2 bits (122), Expect = 2e-07 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = +1 Query: 616 ISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 406 IQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 447 >SB_23576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 53.2 bits (122), Expect = 2e-07 Identities = 23/42 (54%), Positives = 29/42 (69%) Frame = +1 Query: 616 ISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 I +A EE + G+F D SKAFD V+H L+ KL HYGIRG+ Sbjct: 3 IQRAIEEGQYSCGIFLDFSKAFDTVDHKILISKLAHYGIRGI 44 >SB_6009| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 895 Score = 52.8 bits (121), Expect = 3e-07 Identities = 25/41 (60%), Positives = 28/41 (68%) Frame = +1 Query: 616 ISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 +S A + LGVF DLSKAFD V H LL KLH+YGIRG Sbjct: 828 LSSAIDYKKYTLGVFIDLSKAFDTVNHGILLAKLHNYGIRG 868 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +A I N G+ P +K ++++PLFK+G ++N RP+SV Sbjct: 736 IADIINLSTRSGIVPKKLKVARVLPLFKTGDQAFYANYRPVSV 778 >SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) Length = 399 Score = 52.8 bits (121), Expect = 3e-07 Identities = 24/42 (57%), Positives = 28/42 (66%) Frame = +1 Query: 616 ISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 +S A + +GVF DLSKAFD V H LL KL HYGIRG+ Sbjct: 112 LSAAIDNREYTIGVFIDLSKAFDTVNHYILLEKLQHYGIRGI 153 >SB_13949| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 867 Score = 51.6 bits (118), Expect = 6e-07 Identities = 22/47 (46%), Positives = 31/47 (65%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISVPTTY 478 LA ++N I+ G+ PD K +K+IP+FK GS SN RPIS+P + Sbjct: 306 LAMLYNFSIESGIVPDKFKIAKVIPVFKKGSALTLSNYRPISLPPIF 352 >SB_38467| Best HMM Match : RVT_1 (HMM E-Value=4.2e-05) Length = 400 Score = 51.6 bits (118), Expect = 6e-07 Identities = 23/45 (51%), Positives = 30/45 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + I +A E + G+F D SKAFD V+H+ LLRKL HYG RG+ Sbjct: 227 VDKIQKAIELGQYSCGLFLDPSKAFDTVDHSILLRKLEHYGFRGI 271 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/43 (46%), Positives = 28/43 (65%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 LA ++N I+ G+ PD K +K+IP+FK GS N RPIS+ Sbjct: 138 LAMLYNFSIESGIVPDKFKIAKVIPVFKKGSALTLFNYRPISL 180 >SB_10046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 51.2 bits (117), Expect = 9e-07 Identities = 23/49 (46%), Positives = 30/49 (61%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISVPTTYIE 484 L TI N + GV PD++K SKI P+ K G D N RPIS P+T+ + Sbjct: 8 LTTILNQSLQQGVVPDILKISKITPVDKGGEITDPFNFRPISTPSTFTQ 56 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 I + +A + + GVF D SKAFD V + LL KL YGIRG+ Sbjct: 97 INTLRKAIDNNMYTCGVFLDFSKAFDTVNYGILLDKLEAYGIRGL 141 >SB_34368| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 542 Score = 50.4 bits (115), Expect = 1e-06 Identities = 24/41 (58%), Positives = 27/41 (65%) Frame = +1 Query: 616 ISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 +S A + LGVF DLSKAFD V H LL K H+YGIRG Sbjct: 338 LSSAIDYKKYTLGVFIDLSKAFDTVNHGILLAKSHNYGIRG 378 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +A I N G+ P +K + ++PLFK+G ++N RP+SV Sbjct: 246 IADIINLSTRSGIVPKKLKVAGVLPLFKTGDQAFYANYRPVSV 288 >SB_43683| Best HMM Match : RVT_1 (HMM E-Value=0.024) Length = 474 Score = 50.0 bits (114), Expect = 2e-06 Identities = 24/41 (58%), Positives = 27/41 (65%) Frame = +1 Query: 616 ISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 +S A + LG F DLSKAFD V H LL KLH+YGIRG Sbjct: 147 LSNAIDYKKYTLGGFIDLSKAFDTVNHGILLAKLHNYGIRG 187 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/43 (37%), Positives = 27/43 (62%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +A I N G+ P +K ++++PLFK+G ++N RP+SV Sbjct: 55 IADIINLSTRSGIVPKKLKVARVLPLFKAGDQAFYANYRPVSV 97 >SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) Length = 674 Score = 48.4 bits (110), Expect = 6e-06 Identities = 23/43 (53%), Positives = 27/43 (62%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L IFN + VF D K +K+ PL K GS FDH+N RPISV Sbjct: 177 LTKIFNLSVSSCVFSDPWKRAKVSPLLKDGSLFDHTNFRPISV 219 Score = 32.3 bits (70), Expect = 0.42 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKL 717 DL KAFD V+HNTLL KL Sbjct: 285 DLKKAFDLVDHNTLLLKL 302 >SB_58171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 535 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/105 (30%), Positives = 46/105 (43%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXA 331 IS E + D +V F I I I + +N++K + A Sbjct: 247 ISKLEHFVLSRKDPETV-FSIPRIPIGFTINCLQTLNLRKAMGIDKFSAKILKLAAPIIA 305 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P ++ + N I+ FP K +K+ PL+KSG D SN RPISV Sbjct: 306 PSISKLMNYSIESSEFPKRWKTAKVTPLYKSGDHMDKSNYRPISV 350 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGI 732 D KAFD V+H L+ KL YG+ Sbjct: 416 DYRKAFDMVDHIILMSKLKAYGL 438 >SB_36088| Best HMM Match : RVT_1 (HMM E-Value=9e-12) Length = 471 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/105 (30%), Positives = 46/105 (43%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXA 331 IS E + D +V F I I I + +N++K + A Sbjct: 174 ISKLEHFVLSRKDPETV-FSIPRIPIGFTINCLQTLNLRKAMGIDKFSAKILKLAAPIIA 232 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P ++ + N I+ FP K +K+ PL+KSG D SN RPISV Sbjct: 233 PSISKLMNYSIESSEFPKRWKTAKVTPLYKSGDHMDKSNYRPISV 277 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGI 732 D KAFD V+H L+ KL YG+ Sbjct: 343 DYRKAFDMVDHIILMSKLKAYGL 365 >SB_27524| Best HMM Match : RVT_1 (HMM E-Value=1.30321e-43) Length = 593 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/105 (30%), Positives = 46/105 (43%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXA 331 IS E + D +V F I I I + +N++K + A Sbjct: 42 ISKLEHFVLSRKDPETV-FSIPRIPIGFTINCLQTLNLRKAMGIDKFSAKILKLAAPIIA 100 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P ++ + N I+ FP K +K+ PL+KSG D SN RPISV Sbjct: 101 PSISKLMNYSIESSEFPKRWKTAKVTPLYKSGDHMDKSNYRPISV 145 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGI 732 D KAFD V+H L+ KL YG+ Sbjct: 211 DYRKAFDMVDHIILMSKLKAYGL 233 >SB_22068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 987 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/105 (30%), Positives = 46/105 (43%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXA 331 IS E + D +V F I I I + +N++K + A Sbjct: 635 ISKLEHFVLSRKDPETV-FSIPRIPIGFTINCLQTLNLRKAMGIDKFSAKILKLAAPIIA 693 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P ++ + N I+ FP K +K+ PL+KSG D SN RPISV Sbjct: 694 PSISKLMNYSIESSEFPKRWKTAKVTPLYKSGDHMDKSNYRPISV 738 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGI 732 D KAFD V+H L+ KL YG+ Sbjct: 804 DYRKAFDMVDHIILMSKLKAYGL 826 >SB_12012| Best HMM Match : DUF327 (HMM E-Value=2) Length = 232 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/105 (30%), Positives = 46/105 (43%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXA 331 IS E + D +V F I I I + +N++K + A Sbjct: 42 ISKLEHFVLSRKDPETV-FSIPRIPIGFTINCLQTLNLRKAMGIDKFIAKILKLAAPIIA 100 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P ++ + N I+ FP K +K+ PL+KSG D SN RPISV Sbjct: 101 PSISKLMNYSIESSEFPKRWKTAKVTPLYKSGDHMDKSNYRPISV 145 >SB_798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 845 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/105 (30%), Positives = 46/105 (43%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXA 331 IS E + D +V F I I I + +N++K + A Sbjct: 570 ISKLEHFVLSRKDPETV-FSIPRIPIGFTINCLQTLNLRKAMGIDKFSAKILKLAAPIIA 628 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P ++ + N I+ FP K +K+ PL+KSG D SN RPISV Sbjct: 629 PSISKLMNYSIESSEFPKRWKTAKVTPLYKSGDHMDKSNYRPISV 673 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGI 732 D KAFD V+H L+ KL YG+ Sbjct: 739 DYRKAFDMVDHIILMSKLKAYGL 761 >SB_53800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 666 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/105 (30%), Positives = 46/105 (43%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXA 331 IS E + D +V F I I I + +N++K + A Sbjct: 391 ISKLEHFVLSRKDPETV-FSIPRIPIGFTINCLQTLNLRKAMGIDKFSAKILKLAAPIIA 449 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P ++ + N I+ FP K +K+ PL+KSG D SN RPISV Sbjct: 450 PSISKLMNYSIESSEFPKRWKTAKVTPLYKSGDHMDKSNYRPISV 494 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGI 732 D KAFD V+H L+ KL YG+ Sbjct: 560 DYRKAFDMVDHIILMSKLKAYGL 582 >SB_27268| Best HMM Match : RVT_1 (HMM E-Value=2.24208e-44) Length = 548 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/105 (30%), Positives = 46/105 (43%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXA 331 IS E + D +V F I I I + +N++K + A Sbjct: 174 ISKLEHFVLSRKDPETV-FSIPRIPIGFTINCLQTLNLRKAMGIDKFSAKILKLAAPIIA 232 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P ++ + N I+ FP K +K+ PL+KSG D SN RPISV Sbjct: 233 PSISKLMNYSIESSEFPKRWKTAKVTPLYKSGDHMDKSNYRPISV 277 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGI 732 D KAFD V+H L+ KL YG+ Sbjct: 343 DYRKAFDMVDHIILMSKLKAYGL 365 >SB_2851| Best HMM Match : RVT_1 (HMM E-Value=3.50325e-43) Length = 890 Score = 47.6 bits (108), Expect = 1e-05 Identities = 32/105 (30%), Positives = 46/105 (43%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXA 331 IS E + D +V F I I I + +N++K + A Sbjct: 339 ISKLEHFVLSRKDPETV-FSIPRIPIGFTINCLQTLNLRKAMGIDKFSARILKLAAPIIA 397 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P ++ + N I+ FP K +K+ PL+KSG D SN RPISV Sbjct: 398 PSISKLMNYSIESSEFPKRWKTAKVTPLYKSGDHMDKSNYRPISV 442 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGI 732 D KAFD V+H L+ KL YG+ Sbjct: 508 DYRKAFDMVDHIILMSKLKAYGL 530 >SB_30907| Best HMM Match : THAP (HMM E-Value=0.0033) Length = 892 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L IFN I G+FP+ K +K+ PLFK+G D +N RPISV Sbjct: 492 LCLIFNHSIISGIFPEEWKSAKVTPLFKNGQRSDVNNYRPISV 534 >SB_15184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISVPTTYIE 484 L TI N + GV PD++K SKI P+ K G D N RPIS +T+ + Sbjct: 69 LTTILNQSLQQGVVPDILKISKITPVDKGGEITDPFNFRPISTLSTFTQ 117 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/45 (48%), Positives = 27/45 (60%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 I + +A + + GVF D SKAFD V H LL KL YGIRG+ Sbjct: 158 INTLRKAIDNNMYTCGVFLDFSKAFDTVNHGILLDKLEAYGIRGL 202 >SB_9604| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) Length = 317 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/40 (52%), Positives = 26/40 (65%) Frame = +1 Query: 616 ISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIR 735 +S A + +GVF DLSKAFD V H LL KL +YG+R Sbjct: 232 LSSAIDNKEFTMGVFIDLSKAFDVVNHEILLTKLQYYGVR 271 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +A I N I GV P +K +++IPLFKS + N RP+SV Sbjct: 140 IANIINLSISLGVVPKELKIARVIPLFKSCDQALYVNYRPVSV 182 >SB_796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISVPTTYIE 484 L TI N + GV PD++K SKI P+ K G D N RPIS +T+ + Sbjct: 243 LTTILNQSLQQGVVPDILKISKITPVDKGGEITDPFNFRPISTLSTFTQ 291 >SB_30760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1868 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISVPTTYIE 484 L TI N + GV PD++K SKI P+ K G D N RPIS +T+ + Sbjct: 1355 LTTILNQLLQQGVVPDILKISKITPVDKGGEITDPFNFRPISTLSTFTQ 1403 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/45 (48%), Positives = 27/45 (60%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 I + +A + + GVF D SKAFD V H LL KL YGIRG+ Sbjct: 1444 INTLRKAIDNNMYTCGVFLDFSKAFDTVNHGILLDKLEAYGIRGL 1488 >SB_17488| Best HMM Match : Phi-29_GP3 (HMM E-Value=0.69) Length = 250 Score = 47.2 bits (107), Expect = 1e-05 Identities = 22/49 (44%), Positives = 29/49 (59%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISVPTTYIE 484 L TI N + GV PD++K SKI P+ K G D N RPIS +T+ + Sbjct: 111 LTTILNQSLQQGVVPDILKISKITPVDKGGEITDPFNFRPISTLSTFTQ 159 Score = 45.6 bits (103), Expect = 4e-05 Identities = 22/45 (48%), Positives = 27/45 (60%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 I + +A + + GVF D SKAFD V H LL KL YGIRG+ Sbjct: 200 INTLRKAIDNNMYTCGVFLDFSKAFDTVNHGILLDKLEAYGIRGL 244 >SB_11746| Best HMM Match : RVT_1 (HMM E-Value=5e-31) Length = 323 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/45 (46%), Positives = 28/45 (62%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 I I + + + G+F DL KAFD V+H+ LL KL+ YG RGV Sbjct: 71 INTIQRNMDNRFYSCGIFLDLKKAFDTVDHDILLEKLNFYGFRGV 115 >SB_4171| Best HMM Match : Cbl_N3 (HMM E-Value=1.2) Length = 243 Score = 47.2 bits (107), Expect = 1e-05 Identities = 21/40 (52%), Positives = 26/40 (65%) Frame = +1 Query: 616 ISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIR 735 +S A + +GVF DLSKAFD V H LL KL +YG+R Sbjct: 158 LSSAIDNKEFTMGVFIDLSKAFDVVNHEILLTKLQYYGVR 197 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/43 (44%), Positives = 26/43 (60%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +A I N I GV P +K +++IPLFKS + N RP+SV Sbjct: 66 IANIINLSISLGVVPKELKIARVIPLFKSCDQALYVNYRPVSV 108 >SB_39669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 566 Score = 46.8 bits (106), Expect = 2e-05 Identities = 27/87 (31%), Positives = 39/87 (44%) Frame = +2 Query: 206 FKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPD 385 F I I I + +N++K + AP ++ + N I+ FP Sbjct: 209 FSIPRIPIGFTINCLQTLNLRKAMGIDKFSAKILKLAAPIIAPSISKLMNYSIESSEFPK 268 Query: 386 LMKYSKIIPLFKSGSTFDHSNLRPISV 466 K +K+ PL+KSG D SN RPISV Sbjct: 269 RWKTAKVTPLYKSGDHMDKSNYRPISV 295 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGI 732 D KAFD V+H L+ KL YG+ Sbjct: 361 DYRKAFDMVDHIILMSKLKAYGL 383 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/46 (45%), Positives = 27/46 (58%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP +A + N + G FP K +K+ PLFK G D SN RPIS+ Sbjct: 2077 APSIAKLINLSLSSGTFPKRWKLAKVTPLFKKGDRTDPSNYRPISI 2122 >SB_35000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/46 (45%), Positives = 27/46 (58%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP +A + N + G FP K +K+ PLFK G D SN RPIS+ Sbjct: 25 APSIAKLINLSLSSGTFPKRWKLAKVTPLFKKGDRTDPSNYRPISI 70 >SB_799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 370 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/43 (48%), Positives = 27/43 (62%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 ++ IFN I G+ PD KY+++ PLFK G D N RPISV Sbjct: 252 ISHIFNRSISQGIVPDEWKYARVTPLFKQGDRGDVDNYRPISV 294 >SB_10470| Best HMM Match : Herpes_UL33 (HMM E-Value=1.8) Length = 170 Score = 46.0 bits (104), Expect = 3e-05 Identities = 19/43 (44%), Positives = 28/43 (65%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L+T+ N + G+ PD +K +K+IP+FKSG N RPIS+ Sbjct: 45 LSTLINKSLMTGIMPDQLKIAKVIPIFKSGEKEQLKNYRPISI 87 Score = 37.1 bits (82), Expect = 0.015 Identities = 14/36 (38%), Positives = 24/36 (66%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRK 714 ++ I+ ++ + +G+F DLSKAFD + HN L +K Sbjct: 134 VERITSVMDKGLDTIGIFLDLSKAFDTLNHNILTQK 169 >SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) Length = 449 Score = 45.6 bits (103), Expect = 4e-05 Identities = 19/45 (42%), Positives = 28/45 (62%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P L + N I G++PD K SK++P++K G D +N RPIS+ Sbjct: 184 PSLTNLINLSIHTGLYPDKWKCSKVLPVYKKGKRSDMNNYRPISI 228 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIR 735 VF DL+KAFD V H+ L+ KL YG+R Sbjct: 291 VFVDLAKAFDTVNHDILIHKLAKYGLR 317 >SB_36163| Best HMM Match : RVT_1 (HMM E-Value=4.2e-11) Length = 258 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP ++ + N I+ FP K +K+ PL+KSG D SN RPISV Sbjct: 19 APSISKLMNYSIESSEFPKRWKTAKVTPLYKSGDHMDKSNYRPISV 64 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGI 732 D KAFD V+H L+ KL YG+ Sbjct: 130 DYRKAFDMVDHIILMSKLKAYGL 152 >SB_50373| Best HMM Match : HC2 (HMM E-Value=0.001) Length = 382 Score = 45.2 bits (102), Expect = 6e-05 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P L IFN + G+FP K +++ P++K G+ D N RPISV Sbjct: 332 SPSLTEIFNQSLSLGIFPGDWKQTRVTPIYKKGAKSDTINYRPISV 377 >SB_30852| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 623 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P L IFN+ I FPD K ++++PLFK GS N RPIS+ Sbjct: 157 SPSLTYIFNNSIISNCFPDEWKMARVLPLFKKGSKTIPDNYRPISI 202 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = +1 Query: 649 LGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 L VF DL KAFD V H+ LLRKL GI G Sbjct: 263 LVVFLDLKKAFDTVNHDILLRKLELNGITG 292 >SB_6247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 917 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P L IFN+ I FPD K ++++PLFK GS N RPIS+ Sbjct: 401 SPSLTYIFNNSIISNCFPDEWKMARVLPLFKKGSKTIPDNYRPISI 446 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = +1 Query: 649 LGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 L VF DL KAFD V H+ LLRKL GI G Sbjct: 507 LVVFLDLKKAFDTVNHDILLRKLELNGITG 536 >SB_42310| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 940 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P L IFN+ I FPD K ++++PLFK GS N RPIS+ Sbjct: 467 SPSLTYIFNNSIISNCFPDEWKMARVLPLFKKGSKTIPDNYRPISI 512 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = +1 Query: 649 LGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 L VF DL KAFD V H+ LLRKL GI G Sbjct: 573 LVVFLDLKKAFDTVNHDILLRKLELNGITG 602 >SB_36459| Best HMM Match : FlgN (HMM E-Value=2.2) Length = 354 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P L IFN+ I FPD K ++++PLFK GS N RPIS+ Sbjct: 157 SPSLTYIFNNSIISNCFPDEWKMARVLPLFKKGSKTIPDNYRPISI 202 >SB_30215| Best HMM Match : RVT_1 (HMM E-Value=2.6e-34) Length = 875 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P L IFN+ I FPD K ++++PLFK GS N RPIS+ Sbjct: 157 SPSLTYIFNNSIISNCFPDEWKMARVLPLFKKGSKTIPDNYRPISI 202 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P L IFN+ I FPD K ++++PLFK GS N RPIS+ Sbjct: 446 SPSLTYIFNNSIISNCFPDEWKMARVLPLFKKGSKTIPDNYRPISI 491 >SB_14841| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1821 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P L IFN+ I FPD K ++++PLFK GS N RPIS+ Sbjct: 1348 SPSLTYIFNNSIISNCFPDEWKMARVLPLFKKGSKTIPDNYRPISI 1393 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = +1 Query: 649 LGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 L VF DL KAFD V H+ LLRKL GI G Sbjct: 1454 LVVFLDLKKAFDTVNHDILLRKLELNGITG 1483 >SB_9596| Best HMM Match : BAF (HMM E-Value=1.54143e-44) Length = 759 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P L IFN+ I FPD K ++++PLFK GS N RPIS+ Sbjct: 432 SPSLTYIFNNSIISNCFPDEWKMARVLPLFKKGSKTIPDNYRPISI 477 >SB_3943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P L IFN+ I FPD K ++++PLFK GS N RPIS+ Sbjct: 664 SPSLTYIFNNSIISNCFPDEWKMARVLPLFKKGSKTIPDNYRPISI 709 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = +1 Query: 649 LGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 L VF DL KAFD V H+ LLRKL GI G Sbjct: 770 LVVFLDLKKAFDTVNHDILLRKLELNGITG 799 >SB_63| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 680 Score = 45.2 bits (102), Expect = 6e-05 Identities = 21/46 (45%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P L IFN+ I FPD K ++++PLFK GS N RPIS+ Sbjct: 207 SPSLTYIFNNSIISNCFPDEWKMARVLPLFKKGSKTIPDNYRPISI 252 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = +1 Query: 649 LGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 L VF DL KAFD V H+ LLRKL GI G Sbjct: 313 LVVFLDLKKAFDTVNHDILLRKLELNGITG 342 >SB_53688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 491 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/46 (41%), Positives = 30/46 (65%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P+ A I+N+ I G PD+ K S++ P++KSG + N RPIS+ Sbjct: 390 SPFTA-IYNESIASGEVPDIFKISRVTPIYKSGDATEPGNYRPISI 434 >SB_48302| Best HMM Match : HORMA (HMM E-Value=1.1) Length = 330 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/46 (41%), Positives = 30/46 (65%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P+ A I+N+ I G PD+ K S++ P++KSG + N RPIS+ Sbjct: 229 SPFTA-IYNESIASGEVPDIFKISRVTPIYKSGDATEPGNYRPISI 273 >SB_39061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2362 Score = 44.8 bits (101), Expect = 7e-05 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV-PT 472 AP + + N I G FP L K SKI LFKSG + SN RPIS+ PT Sbjct: 2111 APSITNMLNLSIRSGKFPKLWKCSKITALFKSGERTNASNYRPISILPT 2159 Score = 36.7 bits (81), Expect = 0.020 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF DL+KAFD V+H +L+KL GI G Sbjct: 2219 VFIDLTKAFDTVDHEIMLQKLTEIGISG 2246 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 468 LLPTLSKIFEKNIXXXXXXXXXXXXXXX-KQYGFTRGRSTIDA 593 +LPTLSKI E+ I KQ+GF +G ST+ A Sbjct: 2156 ILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSA 2198 >SB_31876| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 630 Score = 44.8 bits (101), Expect = 7e-05 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV-PT 472 AP + + N I G FP L K SKI LFKSG + SN RPIS+ PT Sbjct: 240 APSITNMLNLSIRSGKFPKLWKCSKITALFKSGERTNASNYRPISILPT 288 Score = 35.9 bits (79), Expect = 0.034 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF DL+KAFD V+H +L+KL G+ G Sbjct: 348 VFIDLTKAFDTVDHEIMLQKLTEIGLSG 375 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 468 LLPTLSKIFEKNIXXXXXXXXXXXXXXX-KQYGFTRGRSTIDA 593 +LPTLSKI E+ I KQ+GF +G ST+ A Sbjct: 285 ILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSA 327 >SB_17727| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4e-12) Length = 648 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/46 (41%), Positives = 30/46 (65%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P+ A I+N+ I G PD+ K S++ P++KSG + N RPIS+ Sbjct: 561 SPFTA-IYNESIASGEVPDIFKISRVTPIYKSGDATEPGNYRPISI 605 >SB_1875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/46 (41%), Positives = 30/46 (65%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P+ A I+N+ I G PD+ K S++ P++KSG + N RPIS+ Sbjct: 2 SPFTA-IYNESIASGEVPDIFKISRVTPIYKSGDATEPGNYRPISI 46 >SB_58397| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 281 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/46 (41%), Positives = 30/46 (65%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P+ A I+N+ I G PD+ K S++ P++KSG + N RPIS+ Sbjct: 181 SPFTA-IYNESIASGEVPDIFKISRVTPIYKSGDATEPGNYRPISI 225 >SB_57813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 44.8 bits (101), Expect = 7e-05 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISVPTTY 478 + +IFN + V PD++K SK+ P+ K G TFD +N RPIS +++ Sbjct: 69 ITSIFNLSLLQKVVPDILKISKVTPVDKGGETFDPTNYRPISTLSSF 115 >SB_54849| Best HMM Match : HORMA (HMM E-Value=0.54) Length = 330 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/46 (41%), Positives = 30/46 (65%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P+ A I+N+ I G PD+ K S++ P++KSG + N RPIS+ Sbjct: 229 SPFTA-IYNESIASGEVPDIFKISRVTPIYKSGDATEPGNYRPISI 273 >SB_14872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1182 Score = 44.8 bits (101), Expect = 7e-05 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV-PT 472 AP + + N I G FP L K SKI LFKSG + SN RPIS+ PT Sbjct: 372 APSITNMLNLSIRSGKFPKLWKCSKITALFKSGERTNASNYRPISILPT 420 Score = 35.9 bits (79), Expect = 0.034 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF DL+KAFD V+H +L+KL G+ G Sbjct: 480 VFIDLTKAFDTVDHEIMLQKLTEIGLSG 507 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 468 LLPTLSKIFEKNIXXXXXXXXXXXXXXX-KQYGFTRGRSTIDA 593 +LPTLSKI E+ I KQ+GF +G ST+ A Sbjct: 417 ILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSA 459 >SB_13020| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 44.8 bits (101), Expect = 7e-05 Identities = 19/46 (41%), Positives = 30/46 (65%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P+ A I+N+ I G PD+ K S++ P++KSG + N RPIS+ Sbjct: 377 SPFTA-IYNESIASGEVPDIFKISRVTPIYKSGDATEPGNYRPISI 421 >SB_10718| Best HMM Match : RVT_1 (HMM E-Value=2.3e-33) Length = 365 Score = 44.8 bits (101), Expect = 7e-05 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV-PT 472 AP + + N I G FP L K SKI LFKSG + SN RPIS+ PT Sbjct: 122 APSITNMLNLSIRSGKFPKLWKCSKITALFKSGERTNASNYRPISILPT 170 Score = 35.9 bits (79), Expect = 0.034 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF DL+KAFD V+H +L+KL G+ G Sbjct: 230 VFIDLTKAFDTVDHEIMLQKLTEIGLSG 257 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 468 LLPTLSKIFEKNIXXXXXXXXXXXXXXX-KQYGFTRGRSTIDA 593 +LPTLSKI E+ I KQ+GF +G ST+ A Sbjct: 167 ILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSA 209 >SB_48808| Best HMM Match : DEAD (HMM E-Value=0.029) Length = 498 Score = 44.4 bits (100), Expect = 1e-04 Identities = 22/46 (47%), Positives = 28/46 (60%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 A L IFN I G+FPD K +K+ P+FK+G D +N R ISV Sbjct: 86 AASLCLIFNRSIISGIFPDEWKSAKVTPIFKNGQRSDINNYRHISV 131 >SB_20189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 514 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = +2 Query: 233 DIIG-YFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKII 409 D+IG Y I I K L G+ L I N I +FP + K +++ Sbjct: 242 DLIGRYLSTIKISKATGLDGISAKLLKLAGPAIDMPLCKIINLSIKQSIFPTIWKQAQVT 301 Query: 410 PLFKSGSTFDHSNLRPISV 466 P+FK+G D +N RPIS+ Sbjct: 302 PVFKAGDHLDINNYRPISI 320 >SB_3992| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 354 Score = 44.4 bits (100), Expect = 1e-04 Identities = 19/46 (41%), Positives = 30/46 (65%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P+ A I+N+ I G PD+ K S++ P++KSG + N RPIS+ Sbjct: 163 SPFTA-IYNESIASGEVPDIFKISRVTPIYKSGDDTEPGNYRPISI 207 Score = 42.7 bits (96), Expect = 3e-04 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 ++ + + ++ +F D SKAFD + H+ LL K++ YG+RG Sbjct: 254 VETLKSSIDQGMTTCAIFLDFSKAFDTINHDILLAKMYKYGVRG 297 >SB_58610| Best HMM Match : RVT_1 (HMM E-Value=0.061) Length = 1445 Score = 44.4 bits (100), Expect = 1e-04 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = +2 Query: 233 DIIG-YFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKII 409 D+IG Y I I K L G+ L I N I +FP + K +++ Sbjct: 256 DLIGRYLSTIKISKATGLDGISAKLLKLAGPAIDMPLCKIINLSIKQSIFPTIWKQAQVT 315 Query: 410 PLFKSGSTFDHSNLRPISV 466 P+FK+G D +N RPIS+ Sbjct: 316 PVFKAGDHLDINNYRPISI 334 >SB_38806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 44.4 bits (100), Expect = 1e-04 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV-PT 472 AP + + N I G FP L K SKI LFKSG + SN RPIS+ PT Sbjct: 74 APSITNMLNLSIRSGKFPKLWKCSKITALFKSGDWTNASNYRPISILPT 122 Score = 35.9 bits (79), Expect = 0.034 Identities = 15/28 (53%), Positives = 20/28 (71%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF DL+KAFD V+H +L+KL G+ G Sbjct: 182 VFIDLTKAFDTVDHEIMLQKLTEIGLSG 209 Score = 29.9 bits (64), Expect = 2.3 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 468 LLPTLSKIFEKNIXXXXXXXXXXXXXXX-KQYGFTRGRSTIDA 593 +LPTLSKI E+ I KQ+GF +G ST+ A Sbjct: 119 ILPTLSKILERAIHSQLYQFLVSNGLLSSKQFGFRKGLSTVSA 161 >SB_58595| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1462 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 + ++ A ++ ++ D +KAFD V H L+ KLHHYG RG Sbjct: 634 LHSVGNALDKGQRCDVIYLDFAKAFDSVSHARLIHKLHHYGFRG 677 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDH-SNLRPISV 466 AP L +FN ++ G P K S I+ +FK + N RPIS+ Sbjct: 543 APSLCGLFNKSLELGKLPVEWKKSLIVSIFKKKNRKGRVENYRPISL 589 >SB_33817| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 291 Score = 44.0 bits (99), Expect = 1e-04 Identities = 24/75 (32%), Positives = 32/75 (42%) Frame = +2 Query: 242 GYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFK 421 GY + K L G+ AP L I N I G FP K +K+ P++K Sbjct: 38 GYLLQLQTCKATGLDGISARLLRAAAPAIAPSLTKIINQSIKTGRFPTRWKEAKVCPIYK 97 Query: 422 SGSTFDHSNLRPISV 466 +G N RPIS+ Sbjct: 98 AGDRLSVDNYRPISI 112 Score = 35.5 bits (78), Expect = 0.046 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D KAFD V+H+TL++KL YG+ G Sbjct: 178 DYRKAFDLVDHDTLIKKLSIYGVSG 202 >SB_6954| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 943 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 + ++ A ++ ++ D +KAFD V H L+ KLHHYG RG Sbjct: 225 LHSVGNALDKGQRCDVIYLDFAKAFDSVSHARLIHKLHHYGFRG 268 Score = 32.3 bits (70), Expect = 0.42 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L +FN ++ G P K S I+ +FK N RPIS+ Sbjct: 135 APSLCGLFNKSLELGKLPVEWKKSLIVSIFKKNRKGRVENYRPISL 180 >SB_58023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 789 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/87 (29%), Positives = 37/87 (42%) Frame = +2 Query: 206 FKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPD 385 F+ I + + GY + K L G+ AP L I N I G FP Sbjct: 440 FEIPKIMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPTIAPSLTKIINQSIKTGRFPA 499 Query: 386 LMKYSKIIPLFKSGSTFDHSNLRPISV 466 K +K+ P++K+G N RPIS+ Sbjct: 500 RWKEAKVCPIYKAGDRLSVDNYRPISI 526 Score = 34.7 bits (76), Expect = 0.080 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D KAFD V+H+T+++KL YG+ G Sbjct: 592 DYRKAFDLVDHDTIIKKLSIYGVSG 616 >SB_50273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 253 Score = 44.0 bits (99), Expect = 1e-04 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = +1 Query: 628 WEESHNALGV-FCDLSKAFDCVEHNTLLRKLHHYGIRG 738 W E V + D +KAFD V H L+ KLHHYG+RG Sbjct: 110 WHEKGQQCDVKYFDFAKAFDSVSHARLIHKLHHYGVRG 147 >SB_37633| Best HMM Match : DUF327 (HMM E-Value=2.1) Length = 355 Score = 44.0 bits (99), Expect = 1e-04 Identities = 31/105 (29%), Positives = 45/105 (42%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXA 331 IS E + D +V F I I I + +N++K + A Sbjct: 157 ISKLEHFVLSRKDPETV-FSIPRIPIGFTINCLQTLNLRKAMGIDKFSAKILKLAAPIIA 215 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P ++ + N I+ FP K +K+ PL+KSG D S RPISV Sbjct: 216 PSISKLMNYSIESSEFPKRWKTAKVTPLYKSGDHLDKSIYRPISV 260 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGI 732 D KAFD V+H L+ KL YG+ Sbjct: 326 DYRKAFDMVDHIILMSKLKAYGL 348 >SB_26221| Best HMM Match : RVT_1 (HMM E-Value=1.6e-24) Length = 488 Score = 44.0 bits (99), Expect = 1e-04 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 + ++ A ++ ++ D +KAFD V H L+ KLHHYG RG Sbjct: 168 LHSVGNALDKGQQCDVIYLDFAKAFDSVSHARLIHKLHHYGFRG 211 >SB_25299| Best HMM Match : RVT_1 (HMM E-Value=1.1e-23) Length = 407 Score = 44.0 bits (99), Expect = 1e-04 Identities = 26/87 (29%), Positives = 37/87 (42%) Frame = +2 Query: 206 FKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPD 385 F+ I + + GY + K L G+ AP L I N I G FP Sbjct: 26 FEIPKIMQEFVQGYLLQLQTCKATGLDGISARLLRAAAPTIAPSLTKIINQSIKTGRFPA 85 Query: 386 LMKYSKIIPLFKSGSTFDHSNLRPISV 466 K +K+ P++K+G N RPIS+ Sbjct: 86 RWKEAKVCPIYKAGDRLSVDNYRPISI 112 Score = 34.7 bits (76), Expect = 0.080 Identities = 13/25 (52%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D KAFD V+H+T+++KL YG+ G Sbjct: 178 DYRKAFDLVDHDTIIKKLSIYGVSG 202 >SB_24579| Best HMM Match : rve (HMM E-Value=0.085) Length = 318 Score = 44.0 bits (99), Expect = 1e-04 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = +1 Query: 670 SKAFDCVEHNTLLRKLHHYGIRGV 741 SKAFD V+H+ LLRKL HYGIRG+ Sbjct: 224 SKAFDTVDHSILLRKLEHYGIRGI 247 >SB_31168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/75 (32%), Positives = 32/75 (42%) Frame = +2 Query: 242 GYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFK 421 GY + K L G+ AP L I N I G FP K +K+ P++K Sbjct: 38 GYLLQLQTCKATGLDGISARLLKAAAPAIAPSLTKIINQSIKTGRFPARWKEAKVCPIYK 97 Query: 422 SGSTFDHSNLRPISV 466 +G N RPIS+ Sbjct: 98 AGDRLSVDNYRPISI 112 Score = 35.5 bits (78), Expect = 0.046 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D KAFD V+H+TL++KL YG+ G Sbjct: 178 DYRKAFDLVDHDTLIKKLSIYGVSG 202 >SB_38561| Best HMM Match : Exo_endo_phos (HMM E-Value=2.4) Length = 432 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/75 (32%), Positives = 32/75 (42%) Frame = +2 Query: 242 GYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFK 421 GY + K L G+ AP L I N I G FP K +K+ P++K Sbjct: 350 GYLLQLQTCKATGLDGISARLLRAAAPAIAPSLTKIINQSIKTGRFPARWKEAKVCPIYK 409 Query: 422 SGSTFDHSNLRPISV 466 +G N RPIS+ Sbjct: 410 AGDRLSVDNYRPISI 424 >SB_12038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 43.6 bits (98), Expect = 2e-04 Identities = 24/75 (32%), Positives = 32/75 (42%) Frame = +2 Query: 242 GYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFK 421 GY + K L G+ AP L I N I G FP K +K+ P++K Sbjct: 38 GYLLQLQTCKATGLDGISARLLRAAAPAIAPSLTKIINQSIKTGRFPARWKEAKVCPIYK 97 Query: 422 SGSTFDHSNLRPISV 466 +G N RPIS+ Sbjct: 98 AGDRLSVDNYRPISI 112 >SB_41511| Best HMM Match : SAP (HMM E-Value=2.7e-08) Length = 993 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/46 (43%), Positives = 29/46 (63%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P L+ IFN+ I FPD K ++++PLFK G+ N RPIS+ Sbjct: 845 SPSLSYIFNNAIITCCFPDEWKMARVLPLFKKGAKNIPDNYRPISI 890 Score = 29.9 bits (64), Expect = 2.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 51 KTNDRIITSHQEVASAFVRYFADIPASTTKSL 146 K ND+ I+S +E+A AF YF++I + S+ Sbjct: 754 KINDQSISSPEEIAEAFNSYFSNIGPNLANSM 785 >SB_21018| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 716 Score = 43.2 bits (97), Expect = 2e-04 Identities = 22/41 (53%), Positives = 25/41 (60%) Frame = +1 Query: 616 ISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I QA + + VF DL+KAFD V H LL KL HYGI G Sbjct: 627 IGQALDRGPQSDIVFLDLAKAFDSVSHQRLLWKLSHYGILG 667 >SB_58944| Best HMM Match : fn3 (HMM E-Value=0.88) Length = 697 Score = 43.2 bits (97), Expect = 2e-04 Identities = 30/109 (27%), Positives = 47/109 (43%), Gaps = 3/109 (2%) Frame = +2 Query: 149 FISDAESLLQDHVDKCSVNF-KCTNIG--IKDIIGYFKLINIKKTGDLWGLXXXXXXXXX 319 F+ D+ L + C++ + +NI I DI+ + ++ K + Sbjct: 236 FLKDSLQDLNTDPEHCALPVPELSNISFDINDILSVIRGLDASKASGPDNIPVRLLKETA 295 Query: 320 XXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L IFN I G FP K + I+P++K S N RPIS+ Sbjct: 296 AVIAPSLCQIFNKSIKLGKFPSEWKIAHIVPVYKKDSAQQVENYRPISL 344 >SB_45202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = +1 Query: 670 SKAFDCVEHNTLLRKLHHYGIRGV 741 +KAFD V+H+ LLRKL HYGIRG+ Sbjct: 202 TKAFDTVDHSILLRKLEHYGIRGI 225 >SB_27420| Best HMM Match : PHB_acc (HMM E-Value=6.6) Length = 291 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/43 (44%), Positives = 27/43 (62%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 LA + N + G +PD +K SKI P+FK+ D +N RPIS+ Sbjct: 167 LALLLNMSVAQGTYPDKLKMSKIAPVFKADDELDPNNYRPISL 209 Score = 31.9 bits (69), Expect = 0.56 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLL 708 I I + + + G+F DL KAFD V+H+ LL Sbjct: 256 INTIHRNMDNRFYSCGIFLDLKKAFDTVDHDILL 289 >SB_56575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 42.7 bits (96), Expect = 3e-04 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = +1 Query: 670 SKAFDCVEHNTLLRKLHHYGIRGV 741 +KAFD V+H+ LLRKL HYGIRG+ Sbjct: 269 TKAFDTVDHSILLRKLEHYGIRGI 292 >SB_20001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 722 Score = 42.7 bits (96), Expect = 3e-04 Identities = 19/36 (52%), Positives = 25/36 (69%) Frame = +1 Query: 631 EESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 ++S VF DL KAFD V+H+ LLRKL YG++G Sbjct: 58 DQSLLTANVFNDLKKAFDTVDHSILLRKLSFYGVKG 93 >SB_27488| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 549 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = +1 Query: 673 KAFDCVEHNTLLRKLHHYGIRGV 741 KAFD V+H+ LLRKL HYGIRG+ Sbjct: 2 KAFDTVDHSILLRKLEHYGIRGI 24 >SB_32111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 59 Score = 42.3 bits (95), Expect = 4e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = +1 Query: 673 KAFDCVEHNTLLRKLHHYGIRGV 741 KAFD V+H+ LLRKL HYGIRG+ Sbjct: 2 KAFDTVDHSILLRKLEHYGIRGI 24 >SB_21205| Best HMM Match : Ribosomal_L30_N (HMM E-Value=0.75) Length = 505 Score = 41.9 bits (94), Expect = 5e-04 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 3/109 (2%) Frame = +2 Query: 149 FISDAESLLQDHVDKCSVNF-KCTNIG--IKDIIGYFKLINIKKTGDLWGLXXXXXXXXX 319 F+ D+ L + C+ + +NI I DI+ + ++ K + Sbjct: 384 FLKDSLQDLNTDPEHCAPPVPELSNISFDINDILSVIRGLDASKASGPDNIPVRLLKETA 443 Query: 320 XXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L IFN I G FP K + I+P++K S N RPIS+ Sbjct: 444 AVIAPSLCQIFNKSIKLGKFPSEWKIAHIVPVYKKDSAQQVENYRPISL 492 >SB_47673| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 41.9 bits (94), Expect = 5e-04 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 3/109 (2%) Frame = +2 Query: 149 FISDAESLLQDHVDKCSVNF-KCTNIG--IKDIIGYFKLINIKKTGDLWGLXXXXXXXXX 319 F+ D+ L + C+ + +NI I DI+ + ++ K + Sbjct: 1353 FLKDSLQDLNTDPEHCAPPVPELSNISFDINDILSVIRGLDASKASGPDNIPVRLLKETA 1412 Query: 320 XXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L IFN I G FP K + I+P++K S N RPIS+ Sbjct: 1413 AVIAPSLCQIFNKSIKLGKFPSEWKIAHIVPVYKKDSAQQVENYRPISL 1461 >SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1410 Score = 41.9 bits (94), Expect = 5e-04 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 3/109 (2%) Frame = +2 Query: 149 FISDAESLLQDHVDKCSVNF-KCTNIG--IKDIIGYFKLINIKKTGDLWGLXXXXXXXXX 319 F+ D+ L + C+ + +NI I DI+ + ++ K + Sbjct: 391 FLKDSLQDLNTDPEHCAPPVPELSNISFDINDILSVIRGLDASKASGPDNIPVRLLKETA 450 Query: 320 XXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L IFN I G FP K + I+P++K S N RPIS+ Sbjct: 451 AVIAPSLCQIFNKSIKLGKFPSEWKIAHIVPVYKKDSAQQVENYRPISL 499 Score = 35.5 bits (78), Expect = 0.046 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 V+ D+SKAFD V H L RKL YG G Sbjct: 560 VYLDMSKAFDRVSHRMLTRKLVQYGFGG 587 >SB_20293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1821 Score = 41.9 bits (94), Expect = 5e-04 Identities = 30/109 (27%), Positives = 46/109 (42%), Gaps = 3/109 (2%) Frame = +2 Query: 149 FISDAESLLQDHVDKCSVNF-KCTNIG--IKDIIGYFKLINIKKTGDLWGLXXXXXXXXX 319 F+ D+ L + C+ + +NI I DI+ + ++ K + Sbjct: 339 FLKDSLQDLNTDPEHCAPPVPELSNISFDINDILSVIRGLDASKASGPDNIPVRLLKETA 398 Query: 320 XXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L IFN I G FP K + I+P++K S N RPIS+ Sbjct: 399 AVIAPSLCQIFNKSIKLGKFPSEWKIAHIVPVYKKDSAQQVENYRPISL 447 Score = 35.5 bits (78), Expect = 0.046 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 V+ D+SKAFD V H L RKL YG G Sbjct: 508 VYLDMSKAFDRVSHRMLTRKLVQYGFGG 535 >SB_10854| Best HMM Match : Hormone_4 (HMM E-Value=8.4) Length = 217 Score = 41.5 bits (93), Expect = 7e-04 Identities = 29/109 (26%), Positives = 46/109 (42%), Gaps = 3/109 (2%) Frame = +2 Query: 149 FISDAESLLQDHVDKCSVNF-KCTNIG--IKDIIGYFKLINIKKTGDLWGLXXXXXXXXX 319 F+ D+ L + C+ + +NI + DI+ + ++ K + Sbjct: 38 FLKDSLQDLNTDPEHCAPPVPELSNISFDVNDILSVIRGLDASKASGPDNIPVRLLKETA 97 Query: 320 XXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L IFN I G FP K + I+P++K S N RPIS+ Sbjct: 98 AVIAPSLCQIFNKSIKLGKFPSEWKIAHIVPVYKKDSAQQVENYRPISL 146 >SB_48125| Best HMM Match : RVT_1 (HMM E-Value=8.4e-38) Length = 453 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 VF DL KAFD V+H LL KL+ YGI G+ Sbjct: 150 VFLDLKKAFDTVDHGILLSKLNFYGISGI 178 >SB_45005| Best HMM Match : RVT_1 (HMM E-Value=6.6e-32) Length = 871 Score = 41.5 bits (93), Expect = 7e-04 Identities = 18/29 (62%), Positives = 21/29 (72%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 VF DL KAFD V+H LL KL+ YGI G+ Sbjct: 509 VFLDLKKAFDTVDHGILLSKLNFYGISGI 537 >SB_26005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 947 Score = 41.5 bits (93), Expect = 7e-04 Identities = 23/75 (30%), Positives = 32/75 (42%) Frame = +2 Query: 242 GYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFK 421 GY + K L G+ AP L I N I G FP +K +K+ ++K Sbjct: 304 GYLLQLQTCKATGLDGISARLLRAAAPAIAPSLTKIINQSIKTGRFPARLKEAKVCSIYK 363 Query: 422 SGSTFDHSNLRPISV 466 +G N RPIS+ Sbjct: 364 AGDRLSVDNYRPISI 378 Score = 35.9 bits (79), Expect = 0.034 Identities = 15/25 (60%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D KAFD V+HNTL++KL YG G Sbjct: 444 DYRKAFDLVDHNTLIKKLFIYGASG 468 >SB_2306| Best HMM Match : MecA_N (HMM E-Value=2.3) Length = 262 Score = 41.5 bits (93), Expect = 7e-04 Identities = 16/44 (36%), Positives = 26/44 (59%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 + ++ A ++ ++ D +KAFD V + L+ KLHHYG RG Sbjct: 215 LHSVGNALDKGQQCDVIYLDFAKAFDSVSYARLIHKLHHYGFRG 258 Score = 36.7 bits (81), Expect = 0.020 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L +FN ++ G P K S I+P+FK N RPIS+ Sbjct: 159 APSLCVLFNKSLELGKLPAEWKKSLIVPIFKKNRKERVENYRPISL 204 >SB_12718| Best HMM Match : rve (HMM E-Value=0.0031) Length = 1667 Score = 41.1 bits (92), Expect = 0.001 Identities = 16/23 (69%), Positives = 20/23 (86%) Frame = +1 Query: 673 KAFDCVEHNTLLRKLHHYGIRGV 741 KAFD ++H+ LLRKL HYGIRG+ Sbjct: 2 KAFDTLDHSILLRKLEHYGIRGI 24 >SB_53252| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 366 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/46 (43%), Positives = 25/46 (54%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L IFN I G FP K + I+P++K S N RPIS+ Sbjct: 11 APSLCQIFNKSIKLGKFPSEWKIAHIVPVYKKDSAQQVENYRPISL 56 Score = 35.5 bits (78), Expect = 0.046 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 V+ D+SKAFD V H L RKL YG G Sbjct: 117 VYLDMSKAFDRVSHRMLTRKLVQYGFGG 144 >SB_32446| Best HMM Match : RVT_1 (HMM E-Value=0.04) Length = 197 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H+ LL+KL+HYGI G Sbjct: 36 DYSKAFDKVSHSKLLKKLYHYGIEG 60 >SB_12448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 40.7 bits (91), Expect = 0.001 Identities = 21/41 (51%), Positives = 24/41 (58%) Frame = +1 Query: 616 ISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I QA + + VF DL+KAFD V H LL KL YGI G Sbjct: 264 IGQALDPGLQSYIVFLDLAKAFDSVSHQRLLWKLSRYGISG 304 >SB_28024| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 968 Score = 40.7 bits (91), Expect = 0.001 Identities = 20/46 (43%), Positives = 25/46 (54%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L IFN I G FP K + I+P++K S N RPIS+ Sbjct: 499 APSLCQIFNKSIKLGKFPSEWKIAHIVPVYKKDSAQQVENYRPISL 544 Score = 35.5 bits (78), Expect = 0.046 Identities = 16/28 (57%), Positives = 18/28 (64%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 V+ D+SKAFD V H L RKL YG G Sbjct: 605 VYLDMSKAFDRVSHRMLTRKLVQYGFGG 632 >SB_24270| Best HMM Match : DUF1604 (HMM E-Value=5.2) Length = 329 Score = 40.7 bits (91), Expect = 0.001 Identities = 17/25 (68%), Positives = 20/25 (80%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H+ LL+KL+HYGI G Sbjct: 290 DYSKAFDKVSHSKLLKKLYHYGIEG 314 >SB_49600| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1273 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I ++++A +E+ + D SKAFD V H L++KL +YGI G Sbjct: 692 IHDMAKAIQENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHG 735 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P L +I+ ID G+ P K++ + ++K+G D +N RPIS+ Sbjct: 601 PILTSIYQTSIDTGLVPSRWKHANVCGVYKNGEKSDPANYRPISL 645 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +1 Query: 610 KNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGI 732 KN ++ ++ + + C SK + + H+ +++ L HYGI Sbjct: 630 KNGEKSDPANYRPISLTCIASKVLEHIIHSHVMKHLQHYGI 670 >SB_32796| Best HMM Match : MSG (HMM E-Value=2.7) Length = 270 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 PYL +FN + GVFP IIP+FK G D +N R I++ Sbjct: 221 PYLTRLFNIILRSGVFPQEWNLGFIIPIFKKGDRSDVNNYRGITL 265 >SB_29231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2271 Score = 40.3 bits (90), Expect = 0.002 Identities = 22/89 (24%), Positives = 36/89 (40%) Frame = +2 Query: 200 VNFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVF 379 + K N+ + G +NI+K + A LAT++N CI G + Sbjct: 1926 LRIKQKNLEKGQVSGALGALNIRKATGSDQIPSKLLKIGAEELARPLATLYNSCITAGAW 1985 Query: 380 PDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P K IP++K N RP+++ Sbjct: 1986 PSAWKRGDWIPVYKKDDKLSKENYRPVTI 2014 >SB_19328| Best HMM Match : RVT_1 (HMM E-Value=2e-36) Length = 295 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I ++++A +E+ + D SKAFD V H L++KL +YGI G Sbjct: 94 IHDMAKAIQENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHG 137 >SB_8718| Best HMM Match : Lipase_GDSL (HMM E-Value=0.023) Length = 836 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 PYL +FN + GVFP IIP+FK G D +N R I++ Sbjct: 665 PYLTRLFNIILRSGVFPQEWNLGFIIPIFKKGDRSDVNNYRGITL 709 >SB_3142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2209 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L ++N + GV PD K + IIP++K G N RPIS+ Sbjct: 1531 APSLTQLYNLSLRLGVVPDKWKLANIIPVYKKGDKQQIENYRPISL 1576 Score = 35.9 bits (79), Expect = 0.034 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHH-YGIRG 738 ++ D+SKAFD V+H LL KL H +GI G Sbjct: 1637 IYMDMSKAFDKVDHAALLHKLEHSFGISG 1665 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I ++++A +E+ + D SKAFD V H L++KL +YGI G Sbjct: 230 IHDMAKAIQENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHG 273 Score = 28.3 bits (60), Expect = 6.9 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +1 Query: 640 HNALGVFCDLSKAFDCVEHNTLLRKLHHYGI 732 +N + + C SK + + H+ +++ L HYGI Sbjct: 178 NNPISLTCIASKVLEHIIHSHVMKHLQHYGI 208 >SB_1793| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 864 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I ++++A +E+ + D SKAFD V H L++KL +YGI G Sbjct: 414 IHDMAKAIQENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHG 457 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P L +I+ ID G+ P K++ + ++K+G D +N RPIS+ Sbjct: 323 PILTSIYQTSIDTGLVPSRWKHANVCGVYKNGEKSDPANYRPISL 367 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +1 Query: 610 KNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGI 732 KN ++ ++ + + C SK + + H+ +++ L HYGI Sbjct: 352 KNGEKSDPANYRPISLTCIASKVLEHIIHSHVMKHLQHYGI 392 >SB_462| Best HMM Match : RVT_1 (HMM E-Value=7.7e-25) Length = 863 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I ++++A +E+ + D SKAFD V H L++KL +YGI G Sbjct: 531 IHDMAKAIQENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHG 574 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P L +I+ ID G+ P K++ + ++K+G D +N RPIS+ Sbjct: 440 PILTSIYQTSIDTGLVPSRWKHANVCGVYKNGEKSDPANYRPISL 484 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +1 Query: 610 KNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGI 732 KN ++ ++ + + C SK + + H+ +++ L HYGI Sbjct: 469 KNGEKSDPANYRPISLTCIASKVLEHIIHSHVMKHLQHYGI 509 >SB_45895| Best HMM Match : RVT_1 (HMM E-Value=0.00031) Length = 313 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 PYL +FN + GVFP IIP+FK G D +N R I++ Sbjct: 64 PYLTRLFNIILRSGVFPQEWNLGFIIPIFKKGDRSDVNNYRGITL 108 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I ++++A +E+ + D SKAFD V H L++KL +YGI G Sbjct: 204 IHDMAKAIQENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHG 247 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P L +I+ ID G+ P K++ + ++K+G D +N RPIS+ Sbjct: 113 PILTSIYQTSIDTGLVPSRWKHANVCGVYKNGEKSDPANYRPISL 157 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +1 Query: 610 KNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGI 732 KN ++ ++ + + C SK + + H+ +++ L HYGI Sbjct: 142 KNGEKSDPANYRPISLTCIASKVLEHIIHSHVMKHLQHYGI 182 >SB_41552| Best HMM Match : RVT_1 (HMM E-Value=5.4e-32) Length = 1241 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I ++++A +E+ + D SKAFD V H L++KL +YGI G Sbjct: 570 IHDMAKAIQENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHG 613 >SB_40728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1317 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 PYL +FN + GVFP IIP+FK G D +N R I++ Sbjct: 1028 PYLTRLFNIILRSGVFPQEWNLGFIIPIFKKGDRSDVNNYRGITL 1072 >SB_29272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 719 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I ++++A +E+ + D SKAFD V H L++KL +YGI G Sbjct: 406 IHDMAKAIQENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHG 449 >SB_27722| Best HMM Match : RVT_1 (HMM E-Value=0.00011) Length = 315 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 PYL +FN + GVFP IIP+FK G D +N R I++ Sbjct: 64 PYLTRLFNIILRSGVFPQEWNLGFIIPIFKKGDRSDVNNYRGITL 108 >SB_26566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 PYL +FN + GVFP IIP+FK G D +N R I++ Sbjct: 291 PYLTRLFNIILRSGVFPQEWNLGFIIPIFKKGDRSDVNNYRGITL 335 >SB_22389| Best HMM Match : RVT_1 (HMM E-Value=1.6e-37) Length = 458 Score = 40.3 bits (90), Expect = 0.002 Identities = 19/45 (42%), Positives = 25/45 (55%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 PYL +FN + GVFP IIP+FK G D +N R I++ Sbjct: 64 PYLTRLFNIILRSGVFPQEWNLGFIIPIFKKGDRSDVNNYRGITL 108 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I ++++A +E+ + D SKAFD V H L++KL +YGI G Sbjct: 289 IHDMAKAIQENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHG 332 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P L +I+ ID G+ P K++ + ++K+G D +N RPIS+ Sbjct: 198 PILTSIYQTSIDTGLVPSRWKHANVCGVYKNGEKSDPANYRPISL 242 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +1 Query: 610 KNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGI 732 KN ++ ++ + + C SK + + H+ +++ L HYGI Sbjct: 227 KNGEKSDPANYRPISLTCIASKVLEHIIHSHVMKHLQHYGI 267 >SB_18871| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 546 Score = 40.3 bits (90), Expect = 0.002 Identities = 18/44 (40%), Positives = 28/44 (63%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I ++++A +E+ + D SKAFD V H L++KL +YGI G Sbjct: 222 IHDMAKAIQENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHG 265 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P L +I+ ID G+ P K++ + ++K+G D +N RPIS+ Sbjct: 131 PILTSIYQTSIDTGLVPSRWKHANVCGVYKNGEKSDPANYRPISL 175 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +1 Query: 610 KNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGI 732 KN ++ ++ + + C SK + + H+ +++ L HYGI Sbjct: 160 KNGEKSDPANYRPISLTCIASKVLEHIIHSHVMKHLQHYGI 200 >SB_56449| Best HMM Match : RVT_1 (HMM E-Value=0.28) Length = 419 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H+ LL+KL HYGI G Sbjct: 308 DYSKAFDKVSHSKLLKKLSHYGIEG 332 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/70 (22%), Positives = 28/70 (40%) Frame = +2 Query: 257 INIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTF 436 +N+ K+ G+ + L IFN G P + + ++P+ K + Sbjct: 173 LNVNKSNGPDGISPRVLRDLAKELSGVLCFIFNQSYQEGTLPKIWLNAMVVPVHKKSAKD 232 Query: 437 DHSNLRPISV 466 N RPIS+ Sbjct: 233 QPQNYRPISL 242 >SB_50550| Best HMM Match : RVT_1 (HMM E-Value=7.5e-28) Length = 434 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 LAT++N CI G +P K IP++K N RP+++ Sbjct: 37 LATLYNSCITAGAWPSAWKRGDWIPVYKKDDKLSKENYRPVTI 79 >SB_42160| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1858 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/45 (42%), Positives = 24/45 (53%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 PYL +FN GVFP IIP+FK G D +N R I++ Sbjct: 1308 PYLTRLFNIIFRSGVFPQEWNLGFIIPIFKKGDRSDVNNYRGITL 1352 Score = 34.7 bits (76), Expect = 0.080 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Frame = +1 Query: 613 NISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKL-HHYGIRGV 741 +I A + + V DLS AFD +EH+ LL ++ H YGI + Sbjct: 119 DILTAIDRQQEVVLVLLDLSAAFDTIEHSALLSRMQHRYGINEI 162 >SB_40881| Best HMM Match : RVT_1 (HMM E-Value=2.9e-21) Length = 426 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +1 Query: 613 NISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYG 729 +I++A + L V D SKAFD V + +L+KLHH G Sbjct: 36 DITKAMKRGEVTLAVLADFSKAFDTVAYEVVLKKLHHLG 74 >SB_39766| Best HMM Match : RVT_1 (HMM E-Value=1.8e-07) Length = 392 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 LAT++N CI G +P K IP++K N RP+++ Sbjct: 120 LATLYNSCITAGAWPSAWKRGDWIPVYKKDDKLSKENYRPVTI 162 >SB_39386| Best HMM Match : RVT_1 (HMM E-Value=7.1e-28) Length = 1239 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +1 Query: 613 NISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYG 729 +I++A + L V D SKAFD V + +L+KLHH G Sbjct: 502 DITKAMKRGEVTLAVLADFSKAFDTVAYEVVLKKLHHLG 540 Score = 34.7 bits (76), Expect = 0.080 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L I N CI FP K ++I P+ K D ++LRPIS+ Sbjct: 409 LTHILNTCILQEYFPSAWKVARISPIPKQSDVKDRNDLRPISI 451 >SB_35561| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00092) Length = 813 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +1 Query: 613 NISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYG 729 +I++A + L V D SKAFD V + +L+KLHH G Sbjct: 711 DITKAMKRGEVTLAVLADFSKAFDTVAYEVVLKKLHHLG 749 Score = 36.3 bits (80), Expect = 0.026 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L I N CI FP K ++I P+ K D ++LRPIS+ Sbjct: 618 LTHILNTCISQEYFPSAWKVARISPIPKQADVKDRNDLRPISI 660 >SB_32070| Best HMM Match : RVT_1 (HMM E-Value=2.4e-15) Length = 345 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H+ LL+KL HYGI G Sbjct: 146 DYSKAFDKVSHSKLLKKLSHYGIEG 170 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 LAT++N CI G +P K IP++K N RP+++ Sbjct: 298 LATLYNSCITAGAWPSAWKRGDWIPVYKKDDKLSKENYRPVTI 340 >SB_2746| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H+ LL+KL HYGI G Sbjct: 169 DYSKAFDKVSHSKLLKKLSHYGIEG 193 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/70 (22%), Positives = 28/70 (40%) Frame = +2 Query: 257 INIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTF 436 +N+ K+ G+ + L IFN G P + + ++P+ K + Sbjct: 34 LNVNKSNGPDGISPRVLRDLAKELSGVLCFIFNQSYQEGTLPKIWLNAMVVPVHKKSAKD 93 Query: 437 DHSNLRPISV 466 N RPIS+ Sbjct: 94 QPQNYRPISL 103 >SB_2227| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 377 Score = 39.5 bits (88), Expect = 0.003 Identities = 23/75 (30%), Positives = 31/75 (41%) Frame = +2 Query: 242 GYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFK 421 GY + K L G+ A L I N I G FP K +K+ P++K Sbjct: 124 GYLLQLQTCKATGLDGISARLLRAAAPAIALSLTKIINQSIKTGRFPARWKEAKVCPIYK 183 Query: 422 SGSTFDHSNLRPISV 466 +G N RPIS+ Sbjct: 184 AGDRLSVDNYRPISI 198 Score = 35.5 bits (78), Expect = 0.046 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D KAFD V+H+TL++KL YG+ G Sbjct: 264 DYRKAFDLVDHDTLIKKLSIYGVSG 288 >SB_2102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2396 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H+ LL+KL HYGI G Sbjct: 1707 DYSKAFDKVSHSKLLKKLSHYGIEG 1731 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +1 Query: 628 WEESHNALG----VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 W NA G +F D +KAFD V H LL K YG+RG Sbjct: 1884 WASVLNAHGQVDVIFLDFAKAFDSVPHERLLAKAQFYGVRG 1924 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D K FD V H+TL++KL Y + G Sbjct: 745 DYRKVFDLVNHDTLIKKLSVYSVSG 769 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/70 (22%), Positives = 28/70 (40%) Frame = +2 Query: 257 INIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTF 436 +N+ K+ G+ + L IFN G P + + ++P+ K + Sbjct: 1572 LNVNKSNGPDGISPRVLRDLAKELSGVLCFIFNQSYQEGTLPKIWLNAMVVPVHKKSAKD 1631 Query: 437 DHSNLRPISV 466 N RPIS+ Sbjct: 1632 QPQNYRPISL 1641 >SB_576| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1444 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +1 Query: 613 NISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYG 729 +I++A + L V D SKAFD V + +L+KLHH G Sbjct: 794 DITKAMKRGEVTLAVLADFSKAFDTVAYKVVLKKLHHLG 832 Score = 36.3 bits (80), Expect = 0.026 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L I N CI FP K ++I P+ K D ++LRPIS+ Sbjct: 701 LTHILNTCISQEYFPSAWKVARISPIPKQADVKDRNDLRPISI 743 >SB_55880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 859 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H+ LL+KL HYGI G Sbjct: 735 DYSKAFDKVSHSKLLKKLSHYGIEG 759 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/70 (22%), Positives = 28/70 (40%) Frame = +2 Query: 257 INIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTF 436 +N+ K+ G+ + L IFN G P + + ++P+ K + Sbjct: 600 LNVNKSNGPDGISPRVLRDLAKELSGVLCFIFNQSYQEGTLPKIWLNAMVVPVHKKSAKD 659 Query: 437 DHSNLRPISV 466 N RPIS+ Sbjct: 660 QPQNYRPISL 669 >SB_54962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 LAT++N CI G +P K IP++K N RP+++ Sbjct: 700 LATLYNSCITAGAWPSAWKRGDWIPVYKKDDKLSKENYRPVTI 742 >SB_52616| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1855 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/30 (63%), Positives = 19/30 (63%) Frame = +1 Query: 649 LGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 L VF DL KAFD V H LLRKL Y I G Sbjct: 603 LVVFLDLKKAFDTVNHGVLLRKLEMYSITG 632 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP A++F D G P K + ++ +FK G D N RP+S+ Sbjct: 1519 APIFASLFQQSYDSGKLPSSWKDANVVAIFKKGHRADPKNYRPVSL 1564 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +1 Query: 628 WEESHNALG----VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 W NA G +F D +KAFD V H LL K YG+RG Sbjct: 1614 WASVLNAHGQVDVIFLDFAKAFDSVPHERLLAKAQFYGVRG 1654 Score = 28.3 bits (60), Expect = 6.9 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 392 KYSKIIPLFKSGSTFDHSNLRPISV 466 K ++++PLFK G+ N RPIS+ Sbjct: 518 KMARVLPLFKKGAKNIPDNYRPISI 542 >SB_42168| Best HMM Match : NolV (HMM E-Value=7.1) Length = 414 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 LAT++N CI G +P K IP++K N RP+++ Sbjct: 235 LATLYNSCITAGAWPSAWKRGDWIPVYKKDDKLSKENYRPVTI 277 >SB_31839| Best HMM Match : Exo_endo_phos (HMM E-Value=1.3e-11) Length = 887 Score = 39.5 bits (88), Expect = 0.003 Identities = 15/43 (34%), Positives = 23/43 (53%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 LAT++N CI G +P K IP++K N RP+++ Sbjct: 721 LATLYNSCITAGAWPSAWKRGDWIPVYKKDDKLSKENYRPVTI 763 >SB_27891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 609 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/46 (41%), Positives = 26/46 (56%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L ++N + GV PD K + IIP++K G N RPIS+ Sbjct: 456 APSLTHLYNLSLRLGVVPDEWKLANIIPVYKKGDKQQVENYRPISL 501 Score = 35.1 bits (77), Expect = 0.060 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHH-YGIRG 738 ++ D+SKAFD V+H LL KL H +GI G Sbjct: 562 IYMDMSKAFDKVDHAALLYKLEHSFGISG 590 >SB_19106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 39.5 bits (88), Expect = 0.003 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 637 SHNAL-GVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 SH + + D SKAFD V H L KLHH GIRG Sbjct: 126 SHGQVDAIMLDFSKAFDKVSHTKLSHKLHHCGIRG 160 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 A L IF D G P +K++P+ K + + N RPIS+ Sbjct: 25 ANMLCIIFQQSYDKGTLPLDWSTAKVVPVHKKDNRDNPGNYRPISL 70 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H+ LL+KL HYGI G Sbjct: 1145 DYSKAFDKVSHSKLLKKLSHYGIEG 1169 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/70 (22%), Positives = 28/70 (40%) Frame = +2 Query: 257 INIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTF 436 +N+ K+ G+ + L IFN G P + + ++P+ K + Sbjct: 1010 LNVNKSNGPDGISPRVLRDLAKELSGVLCFIFNQSYQEGTLPKIWLNAMVVPVHKKSAKD 1069 Query: 437 DHSNLRPISV 466 N RPIS+ Sbjct: 1070 QPQNYRPISL 1079 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H+ LL+KL HYGI G Sbjct: 88 DYSKAFDKVSHSKLLKKLSHYGIEG 112 >SB_6960| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 229 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/39 (43%), Positives = 24/39 (61%) Frame = +1 Query: 613 NISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYG 729 +I++A + L V D SKAFD V + +L+KLHH G Sbjct: 36 DITKAMKRGEVTLAVLADFSKAFDTVAYKVVLKKLHHLG 74 >SB_5114| Best HMM Match : RVT_1 (HMM E-Value=1.10002e-42) Length = 330 Score = 39.5 bits (88), Expect = 0.003 Identities = 17/25 (68%), Positives = 19/25 (76%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H+ LL+KL HYGI G Sbjct: 169 DYSKAFDKVSHSKLLKKLSHYGIEG 193 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/70 (22%), Positives = 28/70 (40%) Frame = +2 Query: 257 INIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTF 436 +N+ K+ G+ + L IFN G P + + ++P+ K + Sbjct: 34 LNVNKSNGPDGISPRVLRDLAKELSGVLCFIFNQSYQEGTLPKIWLNAMVVPVHKKSAKD 93 Query: 437 DHSNLRPISV 466 N RPIS+ Sbjct: 94 QPQNYRPISL 103 >SB_10707| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 39.1 bits (87), Expect = 0.004 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 P L +I+ ID G+ P K++ + ++K+G D +N RPIS+ Sbjct: 245 PILTSIYQTSIDTGLVPSRWKHANVCGVYKNGEKSDPANYRPISL 289 Score = 27.9 bits (59), Expect = 9.1 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +1 Query: 610 KNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGI 732 KN ++ ++ + + C SK + + H+ +++ L HYGI Sbjct: 274 KNGEKSDPANYRPISLTCIASKVLEHIIHSHVMKHLQHYGI 314 >SB_59377| Best HMM Match : Exo_endo_phos (HMM E-Value=1.7) Length = 839 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +1 Query: 613 NISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYG 729 +I++A + L V D SKAFD V + +L KLHH G Sbjct: 737 DITKAMKRGEVTLAVLADFSKAFDTVAYEVVLEKLHHLG 775 Score = 36.3 bits (80), Expect = 0.026 Identities = 17/43 (39%), Positives = 23/43 (53%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L I N CI FP K ++I P+ K D ++LRPIS+ Sbjct: 644 LTHILNTCISQEYFPSAWKVARISPIPKQADVKDRNDLRPISI 686 >SB_46483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 245 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 637 SHNAL-GVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 SH + + D SKAFD V H L KLHH GIRG Sbjct: 185 SHGQVDAIMLDFSKAFDKVSHAKLSHKLHHCGIRG 219 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 A L IF D G P +K++P+ K + + N RPIS+ Sbjct: 84 ANMLCIIFQQSYDKGTLPLDWSTAKVVPVHKKDNRDNPGNYRPISL 129 >SB_43617| Best HMM Match : RVT_1 (HMM E-Value=3e-21) Length = 314 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 637 SHNAL-GVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 SH + + D SKAFD V H L KLHH GIRG Sbjct: 49 SHGQVDAIMLDFSKAFDKVSHAKLSHKLHHCGIRG 83 >SB_40804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1044 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/44 (43%), Positives = 27/44 (61%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 I +++QA ++ + + D SKAFD V H+ LL KL HY I G Sbjct: 735 INDLAQASDKKLDTDLILLDFSKAFDTVSHDRLLVKLQHYKIDG 778 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L IF +D G PD +++ + P+ K S N RPIS+ Sbjct: 646 LREIFQQSLDTGDIPDDWRHAFVTPIHKKDSREIPGNYRPISL 688 >SB_38578| Best HMM Match : RVT_1 (HMM E-Value=0.018) Length = 472 Score = 38.7 bits (86), Expect = 0.005 Identities = 18/90 (20%), Positives = 39/90 (43%) Frame = +2 Query: 197 SVNFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGV 376 ++NF + + + + +N++K + A L ++N+CI G Sbjct: 157 NLNFCFQQLSTNSVQSFLEKLNVRKASGYDSITPRLLKLASRGIADSLTGLYNECIRKGE 216 Query: 377 FPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +P+ K + P++K + N RPI++ Sbjct: 217 WPEAWKKGEWNPVYKKDDRLERKNYRPITL 246 >SB_35376| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 931 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 637 SHNAL-GVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 SH + + D SKAFD V H L KLHH GIRG Sbjct: 526 SHGQVDAIMLDFSKAFDKVSHAKLSHKLHHCGIRG 560 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 A L IF D G P +K++P+ K + + SN RPIS+ Sbjct: 425 ANMLCIIFQQSYDKGTLPLDWSTAKVVPVHKKDNRDNPSNYRPISL 470 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/41 (41%), Positives = 26/41 (63%) Frame = +1 Query: 616 ISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 +++A +E+ + D SKAFD V H L++KL +YGI G Sbjct: 1 MAKAIQENKSIHAAVLDFSKAFDKVPHERLIKKLQYYGIHG 41 >SB_5465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 810 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H+ LL KL HYGI G Sbjct: 640 DFSKAFDSVSHSRLLIKLQHYGISG 664 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 637 SHNAL-GVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 SH + + D SKAFD V H L KLHH GIRG Sbjct: 1252 SHGQVDAIMLDFSKAFDKVSHAKLSHKLHHCGIRG 1286 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 A L IF D G P +K++P+ K + + N RPIS+ Sbjct: 1151 ANMLCIIFQQSYDKGTLPLDWSTAKVVPVHKKDNRDNPGNYRPISL 1196 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 ++++ +A + + D SKAFD V H L+ KL YGIRG+ Sbjct: 31 LEDVGKALDLGRQTDRIIMDFSKAFDIVPHQRLISKLDFYGIRGL 75 >SB_36891| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2124 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 637 SHNAL-GVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 SH + + D SKAFD V H L KLHH GIRG Sbjct: 1916 SHGQVDAIMLDFSKAFDKVSHAKLSHKLHHCGIRG 1950 Score = 30.7 bits (66), Expect = 1.3 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 A L IF D G P +K++P+ K + + SN RPIS+ Sbjct: 1815 ANMLCIIFQQSYDKGTLPLDWSTAKVVPVHKKDNRDNPSNYRPISL 1860 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 637 SHNAL-GVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 SH + + D SKAFD V H L KLHH GIRG Sbjct: 236 SHGQVDAIMLDFSKAFDKVSHAKLSHKLHHCGIRG 270 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 A L IF D G P +K++P+ K + + N RPIS+ Sbjct: 135 ANMLCIIFQQSYDKGTLPLDWSTAKVVPVHKKDNRDNPGNYRPISL 180 >SB_28762| Best HMM Match : RVT_1 (HMM E-Value=3.9e-23) Length = 409 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 637 SHNAL-GVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 SH + + D SKAFD V H L KLHH GIRG Sbjct: 49 SHGQVDAIMLDFSKAFDKVSHAKLSHKLHHCGIRG 83 >SB_20796| Best HMM Match : RVT_1 (HMM E-Value=0.047) Length = 660 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L ++N GV PD K + IIP++K G N RPIS+ Sbjct: 442 APSLTHLYNLSFRLGVVPDEWKLANIIPVYKKGDKQQVENYRPISL 487 >SB_20131| Best HMM Match : RVT_1 (HMM E-Value=0.0049) Length = 186 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/37 (51%), Positives = 21/37 (56%) Frame = +1 Query: 628 WEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 W + L + D SKAFD V H LL KL HYGI G Sbjct: 20 WNKQQTDL-LLLDFSKAFDSVSHPRLLIKLQHYGISG 55 >SB_13395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H+ LL KL HYGI G Sbjct: 238 DFSKAFDSVSHSRLLIKLQHYGISG 262 >SB_12274| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 637 SHNAL-GVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 SH + + D SKAFD V H L KLHH GIRG Sbjct: 204 SHGQVDAIMLDFSKAFDKVSHAKLSHKLHHCGIRG 238 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 A L IF D G P +K++P+ K + + N RPIS+ Sbjct: 103 ANMLCIIFQQSYDKGTLPQDWSTAKVVPVHKKDNRDNPGNYRPISL 148 >SB_11572| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 38.7 bits (86), Expect = 0.005 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 637 SHNAL-GVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 SH + + D SKAFD V H L KLHH GIRG Sbjct: 265 SHGQVDAIMLDFSKAFDKVSHAKLSHKLHHCGIRG 299 Score = 29.1 bits (62), Expect = 4.0 Identities = 15/46 (32%), Positives = 22/46 (47%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 A L IF D G P +K++P+ K + + N RPIS+ Sbjct: 164 ANMLCIIFQQSYDKGTLPLDWSTAKVVPVHKKDNRDNPGNYRPISL 209 >SB_10154| Best HMM Match : RVT_1 (HMM E-Value=4.3e-17) Length = 264 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 ++++ +A + + D SKAFD V H L+ KL YGIRG+ Sbjct: 31 LEDVGKALDLGRQTDRIIMDFSKAFDIVPHQRLISKLDFYGIRGL 75 >SB_6691| Best HMM Match : Exo_endo_phos (HMM E-Value=0.0031) Length = 753 Score = 38.7 bits (86), Expect = 0.005 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP A++F D G P K + ++ +FK G D N RP+S+ Sbjct: 697 APIFASLFQQSYDSGKLPSSWKDANVVAIFKKGHRADPKNYRPVSL 742 >SB_53821| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 38.3 bits (85), Expect = 0.006 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP A++F D G P K + ++ +FK G D N RP+S+ Sbjct: 213 APIFASLFQQSYDSGKLPSSWKDANVVAIFKKGHRADLKNYRPVSL 258 >SB_24580| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 366 Score = 38.3 bits (85), Expect = 0.006 Identities = 17/43 (39%), Positives = 25/43 (58%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L I N I +FP + K ++ P+FK+G +D N RPIS+ Sbjct: 3 LGKIINLSIKQSIFPTIWKQVRVTPVFKAGDHWDIHNYRPISI 45 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKL 717 D KAFD V+H+ LLRKL Sbjct: 111 DYRKAFDLVDHDILLRKL 128 >SB_50409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 38.3 bits (85), Expect = 0.006 Identities = 21/89 (23%), Positives = 38/89 (42%) Frame = +2 Query: 218 NIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFPDLMKY 397 +I I ++ + +++ K G+ AP L +FN + P K Sbjct: 128 HISISEVQSTLESLDVTKATGPNGISTRLLKETAPEIAPSLCKLFNKYLSLEAIPQEWKE 187 Query: 398 SKIIPLFKSGSTFDHSNLRPISVPTTYIE 484 + ++P+FK G N RPIS+ + +E Sbjct: 188 ANVVPVFKKGKAELTENYRPISLVSKVLE 216 Score = 33.5 bits (73), Expect = 0.18 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 V+ D+SKAFD V H LL+KL +G G Sbjct: 237 VYMDMSKAFDKVCHTRLLQKLRDFGFGG 264 >SB_56872| Best HMM Match : RVT_1 (HMM E-Value=2.7e-30) Length = 575 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/88 (20%), Positives = 37/88 (42%) Frame = +2 Query: 203 NFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFP 382 NF + + + + +N++K + A L ++N+CI G +P Sbjct: 231 NFCFQQLSTNSVQSFLEKLNVRKASGYDSITPRLLKLASRGIADSLTGLYNECIRKGEWP 290 Query: 383 DLMKYSKIIPLFKSGSTFDHSNLRPISV 466 + K + P++K + N RPI++ Sbjct: 291 EAWKKGEWNPVYKKDDRLERKNYRPITL 318 >SB_51839| Best HMM Match : Gp-FAR-1 (HMM E-Value=2) Length = 337 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/88 (20%), Positives = 37/88 (42%) Frame = +2 Query: 203 NFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFP 382 NF + + + + +N++K + A L ++N+CI G +P Sbjct: 186 NFCFQQLSTNSVQSFLEKLNVRKASGYDSITPRLLKLASRGIADSLTGLYNECIRKGEWP 245 Query: 383 DLMKYSKIIPLFKSGSTFDHSNLRPISV 466 + K + P++K + N RPI++ Sbjct: 246 EAWKKGEWNPVYKKDDRLERKNYRPITL 273 >SB_46263| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 490 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/88 (20%), Positives = 37/88 (42%) Frame = +2 Query: 203 NFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFP 382 NF + + + + +N++K + A L ++N+CI G +P Sbjct: 37 NFCFQQLSTNSVQSFLEKLNVRKASGYDSITPRLLKLASRGIADSLTGLYNECIRKGEWP 96 Query: 383 DLMKYSKIIPLFKSGSTFDHSNLRPISV 466 + K + P++K + N RPI++ Sbjct: 97 EAWKKGEWNPVYKKDDRLERKNYRPITL 124 >SB_46139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 509 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 + D SKAFD V H LL+KL YGIRG Sbjct: 172 ILLDFSKAFDRVAHGRLLQKLDFYGIRG 199 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP+L +F + G P + I +FK G+ SN RPIS+ Sbjct: 64 APFLQKLFTYSLLTGQIPKDWCNANIHAIFKKGNKSLASNYRPISL 109 >SB_26855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/88 (20%), Positives = 37/88 (42%) Frame = +2 Query: 203 NFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFP 382 NF + + + + +N++K + A L ++N+CI G +P Sbjct: 134 NFCFQQLSTNSVQSFLEKLNVRKASGYDSITPRLLKLASRGIADSLTGLYNECIRKGEWP 193 Query: 383 DLMKYSKIIPLFKSGSTFDHSNLRPISV 466 + K + P++K + N RPI++ Sbjct: 194 EAWKKGEWNPVYKKDDRLERKNYRPITL 221 >SB_26585| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 317 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = +1 Query: 649 LGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 L VF DL KAFD V H+ LLRKL GI G Sbjct: 89 LVVFLDLKKAFDTVNHDILLRKLELNGITG 118 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 392 KYSKIIPLFKSGSTFDHSNLRPISV 466 K ++++PLFK GS N RPIS+ Sbjct: 4 KMARVLPLFKKGSKTIPDNYRPISI 28 >SB_25574| Best HMM Match : Gp-FAR-1 (HMM E-Value=1.9) Length = 324 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/88 (20%), Positives = 37/88 (42%) Frame = +2 Query: 203 NFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFP 382 NF + + + + +N++K + A L ++N+CI G +P Sbjct: 231 NFCFQQLSTNSVQSFLEKLNVRKASGYDSITPRLLKLASRGIADSLTGLYNECIRKGEWP 290 Query: 383 DLMKYSKIIPLFKSGSTFDHSNLRPISV 466 + K + P++K + N RPI++ Sbjct: 291 EAWKKGEWNPVYKKDDRLERKNYRPITL 318 >SB_24803| Best HMM Match : LRR_1 (HMM E-Value=0.0066) Length = 727 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 + D SKAFD V H LL+KL YGIRG Sbjct: 29 ILLDFSKAFDRVAHGRLLQKLDFYGIRG 56 >SB_23472| Best HMM Match : HIT (HMM E-Value=0.43) Length = 168 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 ++++ +A + + D SKAFD V H L+ KL YGIRG+ Sbjct: 81 LEDVGKALDLGRQTDLIIMDFSKAFDIVPHQRLISKLDFYGIRGL 125 >SB_21083| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 822 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP +F +D G P +K + ++P+FK G +N RP+S+ Sbjct: 672 APLYTQLFQQSLDQGKLPMDLKIANVVPIFKKGKRSSPNNYRPVSL 717 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H LL KL +YGIRG Sbjct: 783 DFSKAFDRVPHRRLLYKLSYYGIRG 807 >SB_18966| Best HMM Match : RVT_1 (HMM E-Value=0.028) Length = 252 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 ++++ +A + + D SKAFD V H L+ KL YGIRG+ Sbjct: 126 LEDVGKALDLGRQTDLIIMDFSKAFDIVPHQRLISKLDFYGIRGL 170 Score = 34.7 bits (76), Expect = 0.080 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP L +F ++ G P+ + + P+FK G+ SN RPIS+ Sbjct: 34 APALTFLFTQSLETGTLPNDWLSANVTPVFKKGNKNIPSNYRPISL 79 >SB_12308| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 907 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 + D SKAFD V H LL+KL YGIRG Sbjct: 657 ILLDFSKAFDRVAHGRLLQKLDFYGIRG 684 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP+L +F + G P + I +FK G+ SN RPIS+ Sbjct: 549 APFLQKLFTYSLLTGQIPKDWCNANIHAIFKKGNKSLASNYRPISL 594 >SB_2424| Best HMM Match : RVT_1 (HMM E-Value=6.2e-18) Length = 657 Score = 37.9 bits (84), Expect = 0.009 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFPDLMKYSKIIPLF-KSGSTFDHSNLRPIS 463 P + + N+ ++ G+FPD K + ++PL K G NLRP+S Sbjct: 197 PVITKLINNSLESGIFPDCWKEATVVPLLKKQGLESIFKNLRPVS 241 >SB_1034| Best HMM Match : RVT_1 (HMM E-Value=2.2e-30) Length = 558 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/88 (20%), Positives = 37/88 (42%) Frame = +2 Query: 203 NFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFP 382 NF + + + + +N++K + A L ++N+CI G +P Sbjct: 37 NFCFQQLSTNSVQSFLEKLNVRKASGYDSITPRLLKLASRGIADSLTGLYNECIRKGEWP 96 Query: 383 DLMKYSKIIPLFKSGSTFDHSNLRPISV 466 + K + P++K + N RPI++ Sbjct: 97 EAWKKGEWNPVYKKDDRLERKNYRPITL 124 >SB_54423| Best HMM Match : RVT_1 (HMM E-Value=7.7e-32) Length = 775 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/88 (20%), Positives = 37/88 (42%) Frame = +2 Query: 203 NFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFP 382 NF + + + + +N++K + A L ++N+CI G +P Sbjct: 426 NFCFQQLSTNSVQSFLEKLNVRKASGYDSITPRLLKLASRGIADSLTGLYNECIRKGEWP 485 Query: 383 DLMKYSKIIPLFKSGSTFDHSNLRPISV 466 + K + P++K + N RPI++ Sbjct: 486 EAWKKGEWNPVYKKDDRLERKNYRPITL 513 >SB_49562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 ++++ +A + + D SKAFD V H L+ KL YGIRG+ Sbjct: 215 LEDVGKALDLGRQTDLIIMDFSKAFDIVPHQRLISKLDFYGIRGL 259 Score = 30.3 bits (65), Expect = 1.7 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 347 IFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 + +D ++ G P+ + + P+FK G+ SN RPIS+ Sbjct: 129 LVSDSLETGTLPNDWLSANVTPVFKKGNKNIPSNYRPISL 168 >SB_43061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1396 Score = 37.9 bits (84), Expect = 0.009 Identities = 18/88 (20%), Positives = 37/88 (42%) Frame = +2 Query: 203 NFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFP 382 NF + + + + +N++K + A L ++N+CI G +P Sbjct: 1303 NFCFQQLSTNSVQSFLEKLNVRKASGYDSITPRLLKLASRGIADSLTGLYNECIRKGEWP 1362 Query: 383 DLMKYSKIIPLFKSGSTFDHSNLRPISV 466 + K + P++K + N RPI++ Sbjct: 1363 EAWKKGEWNPVYKKDDRLERKNYRPITL 1390 >SB_42505| Best HMM Match : RVT_1 (HMM E-Value=3.9e-18) Length = 264 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 ++++ +A + + D SKAFD V H L+ KL YGIRG+ Sbjct: 31 LEDVGKALDLGRQTDLIIMDFSKAFDIVPHQRLISKLDFYGIRGL 75 >SB_41541| Best HMM Match : RVT_1 (HMM E-Value=3.1e-17) Length = 283 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 ++++ +A + + D SKAFD V H L+ KL YGIRG+ Sbjct: 31 LEDVGKALDLGRQTDLIIMDFSKAFDIVPHQRLISKLDFYGIRGL 75 >SB_38334| Best HMM Match : RVT_1 (HMM E-Value=5.60519e-45) Length = 435 Score = 37.9 bits (84), Expect = 0.009 Identities = 15/46 (32%), Positives = 25/46 (54%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP +F +D G P +K + ++P+FK G +N RP+S+ Sbjct: 93 APLYTQLFQQSLDQGKLPMDLKIANVVPIFKKGKRSSPNNYRPVSL 138 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H LL KL +YGIRG Sbjct: 204 DFSKAFDRVPHRRLLYKLSYYGIRG 228 >SB_36813| Best HMM Match : RVT_1 (HMM E-Value=1.4e-14) Length = 382 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = +1 Query: 649 LGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 L VF DL KAFD V H+ LLRKL GI G Sbjct: 50 LVVFLDLKKAFDTVNHDILLRKLELNGITG 79 >SB_31875| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1478 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = +1 Query: 649 LGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 L VF DL KAFD V H+ LLRKL GI G Sbjct: 8 LVVFLDLKKAFDTVNHDILLRKLELNGITG 37 >SB_25064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1134 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 ++++ +A + + D SKAFD V H L+ KL YGIRG+ Sbjct: 710 LEDVGKALDLGRQTDLIIMDFSKAFDIVPHQRLISKLDFYGIRGL 754 >SB_23493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1230 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 + D SKAFD V H LL+KL YGIRG Sbjct: 1026 ILLDFSKAFDRVAHGRLLQKLDFYGIRG 1053 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP+L +F + G P + I +FK G+ SN RPIS+ Sbjct: 918 APFLQKLFTYSLLTGQIPKDWCNANIHAIFKKGNKSLASNYRPISL 963 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 ++++ +A + + D SKAFD V H L+ KL YGIRG+ Sbjct: 329 LEDVGKALDLGRQTDLIIMDFSKAFDIVPHQRLISKLDFYGIRGL 373 >SB_18909| Best HMM Match : RVT_1 (HMM E-Value=1.2e-28) Length = 591 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 + D SKAFD V H LL+KL YGIRG Sbjct: 146 ILLDFSKAFDRVAHGRLLQKLDFYGIRG 173 >SB_12008| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 979 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/45 (37%), Positives = 26/45 (57%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 ++++ +A + + D SKAFD V H L+ KL YGIRG+ Sbjct: 166 LEDVGKALDLGRQTDLIIMDFSKAFDIVPHQRLISKLDFYGIRGL 210 Score = 29.5 bits (63), Expect = 3.0 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 347 IFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 + +D ++ G P+ + + P+FK G+ SN RPIS+ Sbjct: 80 LVSDSLETGTLPNDWLSANMTPVFKKGNKNIPSNYRPISL 119 >SB_8605| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 284 Score = 37.9 bits (84), Expect = 0.009 Identities = 19/30 (63%), Positives = 20/30 (66%) Frame = +1 Query: 649 LGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 L VF DL KAFD V H+ LLRKL GI G Sbjct: 89 LVVFLDLKKAFDTVNHDILLRKLELNGITG 118 Score = 29.9 bits (64), Expect = 2.3 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 392 KYSKIIPLFKSGSTFDHSNLRPISV 466 K ++++PLFK GS N RPIS+ Sbjct: 4 KMARVLPLFKKGSKTIPDNYRPISI 28 >SB_6188| Best HMM Match : Transposase_23 (HMM E-Value=0.41) Length = 531 Score = 37.9 bits (84), Expect = 0.009 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 + D SKAFD V H LL+KL YGIRG Sbjct: 455 ILLDFSKAFDRVAHGRLLQKLDFYGIRG 482 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP+L +F + G P + I +FK G+ SN RPIS+ Sbjct: 347 APFLQKLFTYSLLTGQIPKDWCNANIHAIFKKGNKSLASNYRPISL 392 >SB_57671| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 533 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF D +KAFD V H+ LL K YGIRG Sbjct: 229 VFLDFAKAFDSVPHDRLLIKAEFYGIRG 256 >SB_55916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +1 Query: 628 WEESHNALG----VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 W NA G +F D +KAFD V H LL K YG+RG Sbjct: 43 WASVLNAHGQVDVIFLDFAKAFDSVPHERLLAKAQFYGVRG 83 >SB_51334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1402 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/29 (55%), Positives = 19/29 (65%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRGV 741 + D SKAFD V H L+ KL YGIRG+ Sbjct: 609 IIMDFSKAFDIVPHQRLISKLDFYGIRGL 637 >SB_44316| Best HMM Match : Exo_endo_phos (HMM E-Value=0.14) Length = 404 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 +A I N G+ P +K ++++PLFK G ++N RP+SV Sbjct: 331 IADIINLSTRSGIVPKKLKVARVLPLFKIGDQAFYANYRPVSV 373 >SB_35480| Best HMM Match : RVT_1 (HMM E-Value=0.0085) Length = 243 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +1 Query: 628 WEESHNALG----VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 W NA G +F D +KAFD V H LL K YG+RG Sbjct: 20 WASVLNAHGQVDVIFLDFAKAFDSVPHERLLAKAQFYGVRG 60 >SB_32837| Best HMM Match : RVT_1 (HMM E-Value=8.3e-17) Length = 327 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +1 Query: 628 WEESHNALG----VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 W NA G +F D +KAFD V H LL K YG+RG Sbjct: 43 WASVLNAHGQVDVIFLDFAKAFDSVPHERLLAKAQFYGVRG 83 >SB_21517| Best HMM Match : UCR_UQCRX_QCR9 (HMM E-Value=7.2) Length = 194 Score = 37.5 bits (83), Expect = 0.011 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP A++F D G P K + + +FK G D N RP+S+ Sbjct: 138 APIFASLFQQSYDSGKLPSSWKNANVAAIFKKGHRADPKNYRPVSL 183 >SB_57427| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00044) Length = 1693 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/37 (45%), Positives = 22/37 (59%) Frame = +1 Query: 607 IKNISQAWEESHNALGVFCDLSKAFDCVEHNTLLRKL 717 + I +A EE + G+F D SKAFD V+H LL L Sbjct: 1648 VDKIQRAIEEGQYSCGIFLDFSKAFDTVDHKFLLANL 1684 Score = 32.7 bits (71), Expect = 0.32 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 L ++N G PD K +K IP+ K S N RPIS+ Sbjct: 1559 LEILYNHSFSNGCVPDQFKIAKTIPIHKKDSASCMDNYRPISL 1601 >SB_38851| Best HMM Match : RVT_1 (HMM E-Value=9.8e-20) Length = 838 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP LA +F D G P K + + +FK G D N RP+S+ Sbjct: 184 APLLAPLFQQSYDSGSLPAAWKDANVTAIFKKGHRADPKNYRPVSL 229 >SB_37732| Best HMM Match : RVT_1 (HMM E-Value=2e-23) Length = 951 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = +1 Query: 628 WEESHNALGVFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 W + + D SKAFD V H+ LL +L HYGI G Sbjct: 584 WIKKQQTDLLLLDFSKAFDSVSHSRLLIQLQHYGISG 620 >SB_26483| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1702 Score = 37.5 bits (83), Expect = 0.011 Identities = 19/41 (46%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +1 Query: 628 WEESHNALG----VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 W NA G +F D +KAFD V H LL K YG+RG Sbjct: 452 WASVLNAHGQVDVIFLDFAKAFDSVPHERLLAKAQFYGVRG 492 Score = 30.3 bits (65), Expect = 1.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 365 DCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 D G P K + ++ +FK G D N RP+S+ Sbjct: 369 DSGKLPSSWKDANVVAIFKKGHRADPKNYRPVSL 402 >SB_20167| Best HMM Match : RhoGEF (HMM E-Value=0.73) Length = 445 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP LA +F D G P K + + +FK G D N RP+S+ Sbjct: 351 APLLAPLFQQSYDSGSLPAAWKDANVTAIFKKGHRADPKNCRPVSL 396 >SB_11838| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1009 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/28 (60%), Positives = 19/28 (67%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF D +KAFD V H+ LL K YGIRG Sbjct: 673 VFLDFAKAFDSVPHDRLLIKAEFYGIRG 700 >SB_9018| Best HMM Match : NolV (HMM E-Value=2.7) Length = 426 Score = 37.5 bits (83), Expect = 0.011 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 338 LATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 LAT++N CI G +P K IP+ K N RP+++ Sbjct: 235 LATLYNSCITAGAWPSAWKRGDWIPVCKKDDKLSKENYRPVTI 277 >SB_3901| Best HMM Match : PkinA_anch (HMM E-Value=2.4) Length = 239 Score = 37.5 bits (83), Expect = 0.011 Identities = 17/46 (36%), Positives = 23/46 (50%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP LA +F D G P K + + +FK G D N RP+S+ Sbjct: 184 APLLAPLFRQSYDSGSLPAAWKDANVTAIFKKGHRADPKNYRPVSL 229 >SB_59792| Best HMM Match : RVT_1 (HMM E-Value=4.2039e-45) Length = 565 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H LL KL +YGIRG Sbjct: 204 DFSKAFDRVPHRRLLYKLSYYGIRG 228 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP +F +D G P K + ++P+FK G +N RP+S+ Sbjct: 93 APLYTQLFQQSLDQGKLPMDWKIANVVPIFKKGKRSSPNNYRPVSL 138 >SB_53427| Best HMM Match : RVT_1 (HMM E-Value=0.031) Length = 969 Score = 37.1 bits (82), Expect = 0.015 Identities = 16/28 (57%), Positives = 19/28 (67%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 + D SKAFD V H +L+KL YGIRG Sbjct: 801 ILLDFSKAFDRVAHGRMLQKLDFYGIRG 828 Score = 27.9 bits (59), Expect = 9.1 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP+L +F + G P + I +FK G+ SN RPIS+ Sbjct: 693 APFLQKLFTYSLLTGQIPKDWCNANIHAIFKKGNKSLASNYRPISL 738 >SB_53367| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1025 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF D +KAFD V H LL K YGIRG Sbjct: 741 VFLDFAKAFDSVPHERLLIKAEFYGIRG 768 >SB_51388| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 670 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H LL KL +YGIRG Sbjct: 204 DFSKAFDRVPHRQLLYKLSYYGIRG 228 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP +F +D G P K + ++P+FK G +N RP+S+ Sbjct: 93 APLYTQLFQQSLDQGKLPMDWKIANVVPIFKKGKRSSPNNYRPVSL 138 >SB_42960| Best HMM Match : RVT_1 (HMM E-Value=2.38221e-44) Length = 455 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H LL KL +YGIRG Sbjct: 94 DFSKAFDRVPHRRLLYKLSYYGIRG 118 >SB_37835| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 295 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF D +KAFD V H LL K YGIRG Sbjct: 139 VFLDFAKAFDSVPHERLLIKAEFYGIRG 166 >SB_36259| Best HMM Match : PHD (HMM E-Value=5.3e-05) Length = 790 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISVPTTYIE 484 AP +F +D G P K + ++P+FK G +N RP+ T IE Sbjct: 668 APLYTQLFQQSLDQGKLPMDWKIANVVPIFKKGKRSSPNNYRPVVYGTVDIE 719 >SB_27537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 396 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H LL KL +YGIRG Sbjct: 35 DFSKAFDRVPHRRLLYKLSYYGIRG 59 >SB_17181| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 668 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H LL KL +YGIRG Sbjct: 307 DFSKAFDRVPHRRLLYKLSYYGIRG 331 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP +F +D G P K + ++P+FK G +N RP+S+ Sbjct: 196 APLYTQLFQQSLDQGKLPMDWKIANVVPIFKKGKRSSPNNYRPVSL 241 >SB_7292| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1126 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H LL KL +YGIRG Sbjct: 765 DFSKAFDRVPHRRLLYKLSYYGIRG 789 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP +F +D G P K + ++P+FK G +N RP+S+ Sbjct: 654 APLYTQLFQQSLDQGKLPMDWKIANVVPIFKKGKRSSPNNYRPVSL 699 >SB_49175| Best HMM Match : RVT_1 (HMM E-Value=1.8e-32) Length = 823 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF D +KAFD V H LL K YGIRG Sbjct: 230 VFLDFAKAFDSVPHERLLIKAEFYGIRG 257 >SB_48371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 811 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H LL KL +YGIRG Sbjct: 307 DFSKAFDRVPHRRLLYKLSYYGIRG 331 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP +F +D G P K + ++P+FK G +N RP+S+ Sbjct: 196 APLYTQLFQQSLDQGKLPMDWKIANVVPIFKKGKRSSPNNYRPVSL 241 >SB_39447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2123 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H LL KL +YGIRG Sbjct: 1930 DFSKAFDRVPHRRLLYKLSYYGIRG 1954 Score = 36.7 bits (81), Expect = 0.020 Identities = 15/46 (32%), Positives = 24/46 (52%) Frame = +2 Query: 329 APYLATIFNDCIDCGVFPDLMKYSKIIPLFKSGSTFDHSNLRPISV 466 AP +F +D G P K + ++P+FK G +N RP+S+ Sbjct: 1819 APLYTQLFQQSLDQGKLPMDWKIANVVPIFKKGKRSSPNNYRPVSL 1864 >SB_39321| Best HMM Match : RVT_1 (HMM E-Value=4.5e-39) Length = 900 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H LL KL +YGIRG Sbjct: 539 DFSKAFDRVPHRRLLYKLSYYGIRG 563 >SB_35779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 305 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF D +KAFD V H LL K YGIRG Sbjct: 47 VFLDFAKAFDSVPHERLLIKAEFYGIRG 74 >SB_33045| Best HMM Match : RVT_1 (HMM E-Value=3.4e-18) Length = 1061 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = +1 Query: 664 DLSKAFDCVEHNTLLRKLHHYGIRG 738 D SKAFD V H LL KL +YGIRG Sbjct: 700 DFSKAFDRVPHRRLLYKLSYYGIRG 724 >SB_30833| Best HMM Match : RVT_1 (HMM E-Value=3.50044e-42) Length = 275 Score = 37.1 bits (82), Expect = 0.015 Identities = 17/28 (60%), Positives = 18/28 (64%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF D +KAFD V H LL K YGIRG Sbjct: 138 VFLDFAKAFDSVPHERLLIKAEFYGIRG 165 >SB_28146| Best HMM Match : Na_Ca_ex (HMM E-Value=0.039) Length = 751 Score = 37.1 bits (82), Expect = 0.015 Identities = 18/88 (20%), Positives = 36/88 (40%) Frame = +2 Query: 203 NFKCTNIGIKDIIGYFKLINIKKTGDLWGLXXXXXXXXXXXXAPYLATIFNDCIDCGVFP 382 NF + + + + +N++K + A L ++N+CI G +P Sbjct: 255 NFCFQQLSTNSVQSFLEKLNVRKASGYDSITPRLLKLASRGIADSLTGLYNECIRKGEWP 314 Query: 383 DLMKYSKIIPLFKSGSTFDHSNLRPISV 466 + K + P +K + N RPI++ Sbjct: 315 EAWKKGEWNPFYKKDDHLERKNYRPITL 342 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,252,214 Number of Sequences: 59808 Number of extensions: 377990 Number of successful extensions: 1922 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 1535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1917 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -