BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0328 (742 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF036692-9|AAB88330.1| 389|Caenorhabditis elegans Hypothetical ... 31 0.65 U58735-1|AAC48148.1| 891|Caenorhabditis elegans Hypothetical pr... 30 1.5 AF054983-1|AAC72298.1| 1066|Caenorhabditis elegans reverse trans... 30 1.5 AF025462-7|AAB71003.1| 805|Caenorhabditis elegans Hypothetical ... 30 1.5 AC087794-3|AAG53700.1| 417|Caenorhabditis elegans Hypothetical ... 29 3.5 Z50006-3|CAA90299.1| 334|Caenorhabditis elegans Hypothetical pr... 28 6.0 L19120-1|AAA28155.1| 815|Caenorhabditis elegans kinesin heavy c... 28 6.0 L07144-3|AAK21446.1| 815|Caenorhabditis elegans Uncoordinated p... 28 6.0 AB017163-1|BAA32594.1| 815|Caenorhabditis elegans kinesin Heavy... 28 6.0 U58756-6|AAY44007.1| 286|Caenorhabditis elegans Hypothetical pr... 28 8.0 >AF036692-9|AAB88330.1| 389|Caenorhabditis elegans Hypothetical protein C44B12.7 protein. Length = 389 Score = 31.5 bits (68), Expect = 0.65 Identities = 13/20 (65%), Positives = 16/20 (80%) Frame = +1 Query: 673 KAFDCVEHNTLLRKLHHYGI 732 KAFD V H+ LL+KLH +GI Sbjct: 2 KAFDQVNHSLLLQKLHDFGI 21 >U58735-1|AAC48148.1| 891|Caenorhabditis elegans Hypothetical protein F20B4.7 protein. Length = 891 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF D KAFD VEH + + L G G Sbjct: 518 VFIDFKKAFDTVEHQAIWKSLDEQGADG 545 >AF054983-1|AAC72298.1| 1066|Caenorhabditis elegans reverse transcriptase protein. Length = 1066 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF D KAFD VEH + + L G G Sbjct: 689 VFIDFKKAFDSVEHQAIWKSLDEQGADG 716 >AF025462-7|AAB71003.1| 805|Caenorhabditis elegans Hypothetical protein K10F12.5 protein. Length = 805 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/28 (46%), Positives = 15/28 (53%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYGIRG 738 VF D KAFD VEH + + L G G Sbjct: 428 VFIDFKKAFDSVEHQAIWKSLDEQGADG 455 >AC087794-3|AAG53700.1| 417|Caenorhabditis elegans Hypothetical protein Y32G9A.9 protein. Length = 417 Score = 29.1 bits (62), Expect = 3.5 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 655 VFCDLSKAFDCVEHNTLLRKLHHYG 729 VF D KAFD VEH + + L G Sbjct: 40 VFIDFKKAFDSVEHQAIWKSLDEQG 64 >Z50006-3|CAA90299.1| 334|Caenorhabditis elegans Hypothetical protein T07C5.2 protein. Length = 334 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 344 TIFNDCIDCGVFPDLMKYSKII 409 T F DC+ CGV L KY K + Sbjct: 2 TNFGDCVVCGVSTHLFKYGKYL 23 >L19120-1|AAA28155.1| 815|Caenorhabditis elegans kinesin heavy chain protein. Length = 815 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGD 280 ++ A SLL H+D+C + GI ++I F + +I D Sbjct: 540 MNQATSLLNAHLDECGPKIRHFKEGIYNVIREFNIADIASQND 582 >L07144-3|AAK21446.1| 815|Caenorhabditis elegans Uncoordinated protein 116 protein. Length = 815 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGD 280 ++ A SLL H+D+C + GI ++I F + +I D Sbjct: 540 MNQATSLLNAHLDECGPKIRHFKEGIYNVIREFNIADIASQND 582 >AB017163-1|BAA32594.1| 815|Caenorhabditis elegans kinesin Heavy chain protein. Length = 815 Score = 28.3 bits (60), Expect = 6.0 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +2 Query: 152 ISDAESLLQDHVDKCSVNFKCTNIGIKDIIGYFKLINIKKTGD 280 ++ A SLL H+D+C + GI ++I F + +I D Sbjct: 540 MNQATSLLNAHLDECGPKIRHFKEGIYNVIREFNIADIASQND 582 >U58756-6|AAY44007.1| 286|Caenorhabditis elegans Hypothetical protein F58F9.9 protein. Length = 286 Score = 27.9 bits (59), Expect = 8.0 Identities = 18/51 (35%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +2 Query: 332 PYLATIFNDCIDCGVFP-DLMKYSKIIPLFKSGSTFDHSNLRPISVPTTYI 481 PY+ I N CG FP D + S+ K G D S +P S T Y+ Sbjct: 94 PYVPMIINGTSQCGPFPKDTGRSSEAPCCPKDGFWSDWSAYKPNSNNTAYV 144 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,673,609 Number of Sequences: 27780 Number of extensions: 310464 Number of successful extensions: 653 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1745954468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -