BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0324 (784 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 27 0.20 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 25 0.79 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 24 1.4 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 24 1.8 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 24 1.8 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 24 1.8 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 24 1.8 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 24 1.8 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 24 1.8 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 24 1.8 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 24 1.8 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 24 1.8 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 24 1.8 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 24 1.8 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 24 1.8 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 24 1.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 24 1.8 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 23 2.4 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 23 2.4 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 23 2.4 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 23 2.4 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 23 2.4 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 23 2.4 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 23 3.2 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 23 3.2 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 23 3.2 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 23 3.2 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 23 3.2 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 23 3.2 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 9.8 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 9.8 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 21 9.8 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 27.1 bits (57), Expect = 0.20 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 342 ISWSMSSMLGLRNRTVPSGYLTELS 268 I W++ ++G+ R VP G+LT S Sbjct: 174 IPWALMPVMGVWGRFVPEGFLTSCS 198 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 25.0 bits (52), Expect = 0.79 Identities = 10/37 (27%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ R Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQRSYKNENSYRKYR 293 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 24.2 bits (50), Expect = 1.4 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSCSREREQKSYKNENSYRKYR 293 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 293 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 246 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 282 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 293 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 293 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 246 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 282 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 293 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 23.8 bits (49), Expect = 1.8 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 262 NEKEKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 298 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 23.8 bits (49), Expect = 1.8 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -3 Query: 755 SVLEHSSGLHRRLHRK*QPYR 693 SV E+ S +HRR+H K +PY+ Sbjct: 130 SVKENLS-VHRRIHTKERPYK 149 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYR 60 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYR 60 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYR 60 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYR 60 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKKKLLEERTSRKRYSRSREREQKSYKNENSYRKYR 293 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 23.4 bits (48), Expect = 2.4 Identities = 9/37 (24%), Positives = 20/37 (54%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ ++ + R + Y ++ + Y + +YRKYR Sbjct: 257 NEKEKLLEERTSRKRYSRSREREKKSYKNENSYRKYR 293 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ + + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ + + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ + + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ + + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ + + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.0 bits (47), Expect = 3.2 Identities = 9/37 (24%), Positives = 19/37 (51%) Frame = -1 Query: 661 SEEHRITDFRVVHQLYDFVKQDSDRRYAHTVTYRKYR 551 +E+ + + R + Y ++ + Y + +YRKYR Sbjct: 24 NEKEKFLEERTSRKRYSRSREREQKSYKNENSYRKYR 60 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 133 YKNERPHQRY 162 YKNER +Q+Y Sbjct: 50 YKNEREYQKY 59 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 133 YKNERPHQRY 162 YKNER +Q+Y Sbjct: 50 YKNEREYQKY 59 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 133 YKNERPHQRY 162 YKNER +Q+Y Sbjct: 50 YKNEREYQKY 59 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 133 YKNERPHQRY 162 YKNER +Q+Y Sbjct: 50 YKNEREYQKY 59 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 133 YKNERPHQRY 162 YKNER +Q+Y Sbjct: 50 YKNEREYQKY 59 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 133 YKNERPHQRY 162 YKNER +Q+Y Sbjct: 50 YKNEREYQKY 59 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.8 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +1 Query: 133 YKNERPHQRY 162 YKNER +Q+Y Sbjct: 50 YKNEREYQKY 59 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.4 bits (43), Expect = 9.8 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = -3 Query: 386 QQDHGSRSQGPNGREYLGP 330 QQDHGS G G P Sbjct: 97 QQDHGSGMDGMGGYRSASP 115 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 237,058 Number of Sequences: 438 Number of extensions: 5545 Number of successful extensions: 41 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -