BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0321 (841 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z93785-5|CAB07861.3| 321|Caenorhabditis elegans Hypothetical pr... 33 0.25 Z79754-1|CAB02090.1| 457|Caenorhabditis elegans Hypothetical pr... 29 4.1 AF026213-4|AAB71305.2| 458|Caenorhabditis elegans Cell death ab... 28 9.5 >Z93785-5|CAB07861.3| 321|Caenorhabditis elegans Hypothetical protein W09D10.5 protein. Length = 321 Score = 33.1 bits (72), Expect = 0.25 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = +2 Query: 308 LRKLRGRRSMIFSTLIENIEKKCKTLIFFKNNA*KIH*IDKENITHTTYHVFDAHTHAYY 487 L K + I S + + K C+ IFF NN K +T YHV + H Y+ Sbjct: 70 LHKATHKPENIISAITDGYAKLCQETIFFTNNQKLFDKFQKFQNNYTMYHVDSSLNHFYW 129 >Z79754-1|CAB02090.1| 457|Caenorhabditis elegans Hypothetical protein F25H2.1 protein. Length = 457 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 372 FFSIFSISVENIILLRPRNFRKKGYKVFASCINI 271 FF + + ++ I +PR FRK+ YKV IN+ Sbjct: 225 FFQLKYLPIKRITHCQPRRFRKQLYKVIIFRINV 258 >AF026213-4|AAB71305.2| 458|Caenorhabditis elegans Cell death abnormality protein 8 protein. Length = 458 Score = 27.9 bits (59), Expect = 9.5 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +3 Query: 447 LRTMYLTHTRMHTIYCQAFVLDVCCQIENRLNII 548 L +++L T +H I+ QA +D C IE L +I Sbjct: 292 LISVHLLVTLVHVIFLQAIHIDACTHIEKLLLLI 325 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,638,257 Number of Sequences: 27780 Number of extensions: 366044 Number of successful extensions: 685 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 667 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 685 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2077023564 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -