BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0320 (894 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 25 0.80 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.4 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 23 3.2 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 22 5.6 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 22 7.5 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 22 7.5 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 25.0 bits (52), Expect = 0.80 Identities = 13/46 (28%), Positives = 22/46 (47%) Frame = +3 Query: 543 ESNLQEVVFDHLHATAFQGTPLGQTILGPTKNIKKISKADLQSYIR 680 E N+ + V H + + G GP ++ S+ DLQ+Y+R Sbjct: 500 EINIMKSVRQHPYIVSLIGCVTEGRAEGPLLVVEYCSRGDLQTYLR 545 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.2 bits (50), Expect = 1.4 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 379 FKCAPMFSTSSSKSVCDLLLVPLKAMC 299 F CAP ++K++CD P KA C Sbjct: 1305 FNCAPGLHWDNNKNICDW---PEKATC 1328 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 23.0 bits (47), Expect = 3.2 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = -2 Query: 473 LYDISKDLYCYGDVISEAFCVKNCLFPGRVGV 378 ++D+S D +C GD C +NC+ +V + Sbjct: 544 IHDLSPDQFCNGD-NRPPDCGQNCMCTHQVDI 574 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.2 bits (45), Expect = 5.6 Identities = 7/12 (58%), Positives = 11/12 (91%) Frame = -1 Query: 255 GSQRRSRVLQWQ 220 G+ R++RVLQW+ Sbjct: 81 GTNRKNRVLQWR 92 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 21.8 bits (44), Expect = 7.5 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +3 Query: 9 GKNILTHSIKITTKMLKVATTLRVISSQGNQVRTLATAAAYKQ 137 GK L +++ T + LR ++ +TLA+ +AY Q Sbjct: 116 GKTTLLNTLTFHTSSNLTVSGLRCVNGIPVSSKTLASQSAYVQ 158 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 21.8 bits (44), Expect = 7.5 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +3 Query: 9 GKNILTHSIKITTKMLKVATTLRVISSQGNQVRTLATAAAYKQ 137 GK L +++ T + LR ++ +TLA+ +AY Q Sbjct: 116 GKTTLLNTLTFHTSSNLTVSGLRCVNGIPVSSKTLASQSAYVQ 158 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,441 Number of Sequences: 336 Number of extensions: 4770 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 57 effective length of database: 103,433 effective search space used: 24823920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -