BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0317 (807 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0448 + 18015609-18016052,18017147-18017248,18017332-180174... 31 1.4 >10_08_0448 + 18015609-18016052,18017147-18017248,18017332-18017475, 18017555-18017705,18017793-18017820,18018456-18018621, 18018701-18018764,18019320-18019423,18019572-18019710, 18020114-18020232,18020333-18020485,18020565-18020654, 18020952-18021029,18021671-18021829,18021914-18022117, 18022209-18022414,18022495-18022630,18022859-18022898, 18023329-18023408,18023569-18024228 Length = 1088 Score = 30.7 bits (66), Expect = 1.4 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 210 VTSSIKVAKRKLFRSIGVLNIYILSCQYHSSFCQYC 317 + S+ V KR+ RSI +L+IY +SF Q+C Sbjct: 511 INKSLSVGKRRTGRSISILDIYGFESFDRNSFEQFC 546 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,459,614 Number of Sequences: 37544 Number of extensions: 255759 Number of successful extensions: 419 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 419 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2197677108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -