BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0316 (751 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 294 7e-82 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 24 1.8 AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellif... 24 1.8 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 23 2.3 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 23 2.3 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 2.3 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 4.0 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 4.0 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 22 5.3 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 5.3 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 22 5.3 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 22 5.3 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 22 5.3 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 22 5.3 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 5.3 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 5.3 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 5.3 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 5.3 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 5.3 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 5.3 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 5.3 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 22 5.3 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 22 5.3 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 22 5.3 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 5.3 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 22 5.3 AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex det... 22 5.3 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 5.3 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 5.3 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 5.3 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 7.1 >DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monooxygenase protein. Length = 548 Score = 294 bits (721), Expect = 7e-82 Identities = 138/214 (64%), Positives = 175/214 (81%), Gaps = 1/214 (0%) Frame = +2 Query: 113 FSAINLFYVLLVPAVILWYAYWRMSRRRLYELADKLNXXXXXXXXXNALEFVGGSADIFR 292 FSA ++F LL+PA+IL++ Y+R+SRR L ELA+K+ NAL+ G +F Sbjct: 9 FSASSVFLSLLIPALILYFIYFRISRRHLLELAEKIPGPPALPLIGNALDLFGSPDAMFS 68 Query: 293 NIVQKSADYDHESVVKIWIGPRLLVFLYDPRDVEVILSSHVYIDKAEEYRFFKPWLGNGL 472 +++K+ ++ + VVKIW+GP+L++ L DPRDVE+ILSS+VYIDK+ EYRFFKPWLG+GL Sbjct: 69 QVLKKAENF--KDVVKIWVGPKLVICLIDPRDVEIILSSNVYIDKSTEYRFFKPWLGDGL 126 Query: 473 LISTGQKWRSHRKLIAPTFHLNVLKSFIDLFNANSRAVVDKLKKE-ASNFDCHDYMSECT 649 LISTGQKWR+HRKLIAPTFHLNVLKSFIDLFNAN+R+VV+K++KE FDCH+YMSE T Sbjct: 127 LISTGQKWRNHRKLIAPTFHLNVLKSFIDLFNANARSVVEKMRKENGKEFDCHNYMSELT 186 Query: 650 VEILLETAMGVSKSTQDQSGFEYAMAVMKMCDIL 751 V+ILLETAMGVSK T+D + FEYAMAVMKMCDIL Sbjct: 187 VDILLETAMGVSKPTRDHNAFEYAMAVMKMCDIL 220 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 23.8 bits (49), Expect = 1.8 Identities = 14/32 (43%), Positives = 16/32 (50%), Gaps = 1/32 (3%) Frame = +3 Query: 300 FRKALTTITNPSLRSG*DLVSSSFCT-ILATW 392 FRK L NPSLR G S+ C +L W Sbjct: 27 FRKGLRLHDNPSLREGLAGASTFRCVFVLDPW 58 >AJ968562-1|CAI91546.1| 998|Apis mellifera protein ( Apis mellifera ORF for hypotheticalprotein. ). Length = 998 Score = 23.8 bits (49), Expect = 1.8 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +3 Query: 489 KNGGLIVNLSPPH 527 +NG LI N+ PPH Sbjct: 752 RNGALIYNILPPH 764 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = +3 Query: 576 QELLWTNLKRKLVIL 620 +ELLWT++K+ L+I+ Sbjct: 803 KELLWTSVKKALMIV 817 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/15 (53%), Positives = 14/15 (93%) Frame = +3 Query: 576 QELLWTNLKRKLVIL 620 +ELLWT++K+ L+I+ Sbjct: 841 KELLWTSVKKALMIV 855 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.4 bits (48), Expect = 2.3 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S +T V Sbjct: 123 EIHRDLPGKSTITTV 137 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 4.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 123 EIHRDLPGKSTTTSV 137 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 Query: 273 PPTNSRAFPSNGSPGGPFSLSAS 205 PP S+ P G PG P S + S Sbjct: 39 PPNPSQGPPPGGPPGAPPSQNPS 61 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 123 EIHRDLPGKSTTTTV 137 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 123 EIHRDLPGKSTTTTV 137 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 123 EIHRDLPGKSTTTTV 137 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 123 EIHRDLPGKSTTTTV 137 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 139 EIHRDLPGKSTTTTV 153 >AY352276-1|AAQ67417.1| 385|Apis mellifera complementary sex determiner protein. Length = 385 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 278 QIHRRIPGRSRVTEV 234 +IHR +PG+S T V Sbjct: 134 EIHRDLPGKSTTTTV 148 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +2 Query: 113 FSAINLFYVLLVPAVILWYAYWRMSRRR 196 +S+++ FY+ + V L+Y ++ R R Sbjct: 346 YSSLSSFYIPCIIMVFLYYNIFKALRNR 373 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,080 Number of Sequences: 438 Number of extensions: 4212 Number of successful extensions: 40 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -