BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0314 (793 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43404| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.5 SB_17775| Best HMM Match : Coiled (HMM E-Value=2.3) 28 10.0 >SB_43404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 7.5 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = -1 Query: 190 YLQ*KNVIDYLIHG-SLSPLTAKAFSSSSSCGIPLTVNWE**GTVYGGP 47 Y + +N+I ++ SLS L++ + SSSSS IP+ V + GTV P Sbjct: 259 YHRRRNIIIIIVVAISLSSLSSSSSSSSSSYSIPVRVTNKKDGTVKDSP 307 >SB_17775| Best HMM Match : Coiled (HMM E-Value=2.3) Length = 877 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -1 Query: 730 WDLLYKICKNMHKIWHSYIVLYEYIRHLFLLGNYNS 623 WD L+ ++ + + YI + IR+ + GNYNS Sbjct: 268 WDALFAEGTHLDLVDYIYIGMLHSIRNKLMAGNYNS 303 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,510,633 Number of Sequences: 59808 Number of extensions: 429715 Number of successful extensions: 704 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 666 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 704 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -