Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= an--0314
         (793 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g15940.1 68414.m01913 expressed protein similar To androgen-i...    30   1.5  

>At1g15940.1 68414.m01913 expressed protein similar To
           androgen-induced prostate proliferative shutoff
           associated protein (GI:4559410) [Homo sapiens]
          Length = 990

 Score = 30.3 bits (65), Expect = 1.5
 Identities = 15/36 (41%), Positives = 18/36 (50%)
 Frame = +3

Query: 360 VYMGCTCSTQQTIIS*SHLVQNSQVIYMPVVSSVCQ 467
           V   CTC  Q  I+        S  +Y PVVSS+CQ
Sbjct: 222 VLSSCTCKLQPCIMEALKSSGTSLDMYSPVVSSICQ 257


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,875,729
Number of Sequences: 28952
Number of extensions: 303884
Number of successful extensions: 589
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 581
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 589
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1785055200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)