BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0307 (847 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17C9.12 |||MSP domain|Schizosaccharomyces pombe|chr 1|||Manual 27 2.5 SPBC14F5.06 |||iron-sulfur protein|Schizosaccharomyces pombe|chr... 26 7.7 >SPAC17C9.12 |||MSP domain|Schizosaccharomyces pombe|chr 1|||Manual Length = 319 Score = 27.5 bits (58), Expect = 2.5 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 6/50 (12%) Frame = -2 Query: 156 INGICNLEYSAGVCGAAQDL----PIEV--TATTRHTQPSSTWAGPPESP 25 +NG N YS G+ G A P+ TATT+HTQ T A + P Sbjct: 156 VNGNVNQSYSKGIDGTALPSTHANPVAAPSTATTQHTQLPKTSAVSHQKP 205 >SPBC14F5.06 |||iron-sulfur protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 593 Score = 25.8 bits (54), Expect = 7.7 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = -3 Query: 290 PADRRSDLGLSVCLGLSVCHCYCNFGS 210 P DR + + ++C+G +C C FG+ Sbjct: 43 PTDRIAFISETLCIGCGICVKKCPFGA 69 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,707,624 Number of Sequences: 5004 Number of extensions: 52078 Number of successful extensions: 116 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 110 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -