BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0307 (847 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:100... 33 0.32 At4g10170.2 68417.m01665 synaptobrevin-related family protein si... 29 5.1 At4g10170.1 68417.m01664 synaptobrevin-related family protein si... 29 5.1 At4g01040.1 68417.m00141 glycosyl hydrolase family 18 protein co... 28 6.8 At4g19180.1 68417.m02830 nucleoside phosphatase family protein /... 28 9.0 >At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:1000090) [Gossypium barbadense] Length = 335 Score = 32.7 bits (71), Expect = 0.32 Identities = 19/81 (23%), Positives = 33/81 (40%) Frame = +2 Query: 554 PEVSDNRQHINNVYVKGPPRTENFNFQNDRIHAEENYQNNQGSYVTQPPEHDRXXNDYYN 733 P +S+ + NN P +TEN+ + + E + NN Y E ++ N Sbjct: 119 PSLSETEESFNNYEENYPKKTENYGTKG---YNNEEFNNNNNKYDANFKE------EFNN 169 Query: 734 QKTDYXIQYSDYNNQNDRGRF 796 K D ++NN N+ + Sbjct: 170 NKYDENYAKEEFNNNNNNNNY 190 >At4g10170.2 68417.m01665 synaptobrevin-related family protein similar to Vesicle-associated membrane protein 722 (AtVAMP722) Synaptobrevin-related protein 1 (SP:P47192) {Arabidopsis thaliana}; vesicle-associated membrane protein 7B, Arabidopsis thaliana, AF025333 Length = 254 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/56 (23%), Positives = 26/56 (46%) Frame = +2 Query: 635 NDRIHAEENYQNNQGSYVTQPPEHDRXXNDYYNQKTDYXIQYSDYNNQNDRGRFTN 802 N+ + + + ++GS T+ P R + D+ I+ ++ NDRG T+ Sbjct: 136 NNELKSSNLGEQSEGSNSTKAPLLGRLSKQEKKKGKDHVIELEEHRKSNDRGNITD 191 >At4g10170.1 68417.m01664 synaptobrevin-related family protein similar to Vesicle-associated membrane protein 722 (AtVAMP722) Synaptobrevin-related protein 1 (SP:P47192) {Arabidopsis thaliana}; vesicle-associated membrane protein 7B, Arabidopsis thaliana, AF025333 Length = 254 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/56 (23%), Positives = 26/56 (46%) Frame = +2 Query: 635 NDRIHAEENYQNNQGSYVTQPPEHDRXXNDYYNQKTDYXIQYSDYNNQNDRGRFTN 802 N+ + + + ++GS T+ P R + D+ I+ ++ NDRG T+ Sbjct: 136 NNELKSSNLGEQSEGSNSTKAPLLGRLSKQEKKKGKDHVIELEEHRKSNDRGNITD 191 >At4g01040.1 68417.m00141 glycosyl hydrolase family 18 protein contains Pfam profile PF00704: Glycosyl hydrolases family 18 Length = 430 Score = 28.3 bits (60), Expect = 6.8 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 566 DNRQHINNVYVKGPPRTE 619 +N+QH+ +YV GPPR+E Sbjct: 247 NNQQHMQFMYVVGPPRSE 264 >At4g19180.1 68417.m02830 nucleoside phosphatase family protein / GDA1/CD39 family protein low similarity to SP|O18956 Ectonucleoside triphosphate diphosphohydrolase 1 (EC 3.6.1.5) (Ecto-apyrase) {Bos taurus}; contains Pfam profile PF01150: GDA1/CD39 (nucleoside phosphatase) family Length = 740 Score = 27.9 bits (59), Expect = 9.0 Identities = 11/20 (55%), Positives = 16/20 (80%) Frame = +1 Query: 361 WSNNRRSESILQSKRQQSKQ 420 WS+ RRS+ LQS+R QS++ Sbjct: 707 WSSPRRSQMRLQSRRSQSRE 726 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,536,101 Number of Sequences: 28952 Number of extensions: 291763 Number of successful extensions: 746 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1960634400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -