BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0304 (800 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC824.08 |gda1|gdp1|guanosine-diphosphatase Gda1|Schizosacchar... 27 3.1 SPBC776.17 |||rRNA processing protein Rrp7 |Schizosaccharomyces ... 27 3.1 >SPAC824.08 |gda1|gdp1|guanosine-diphosphatase Gda1|Schizosaccharomyces pombe|chr 1|||Manual Length = 556 Score = 27.1 bits (57), Expect = 3.1 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +3 Query: 399 YRFDNANTDDNLNRNFFKSLENVCTSF 479 Y+F+N N L FFK +E +SF Sbjct: 150 YQFNNCNPSPKLEEEFFKMIEPGLSSF 176 >SPBC776.17 |||rRNA processing protein Rrp7 |Schizosaccharomyces pombe|chr 2|||Manual Length = 254 Score = 27.1 bits (57), Expect = 3.1 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 115 LFIYLYENERMECLFVYQKRVDSIKRNNYLINV 213 L IYL +R+ +F+ + D K++ YLINV Sbjct: 12 LEIYLENKKRLHSIFLKEDTEDVEKKSLYLINV 44 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,859,454 Number of Sequences: 5004 Number of extensions: 57374 Number of successful extensions: 118 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 388424860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -