BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0304 (800 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55279| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.62 >SB_55279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 31.9 bits (69), Expect = 0.62 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +1 Query: 460 KTYVLLLFLIMF*YPVTFPLLLYYILIK*NCRIPTRI 570 K Y+L L++ + P+T +LLY ++K NC RI Sbjct: 326 KAYILALYIYVHIVPITLVILLYGFILKANCIQTCRI 362 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,105,280 Number of Sequences: 59808 Number of extensions: 349752 Number of successful extensions: 646 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2215746665 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -