BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0300 (565 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g41440.1 68415.m05120 expressed protein 31 0.70 At1g07550.1 68414.m00808 leucine-rich repeat protein kinase, put... 30 1.2 At1g08620.1 68414.m00955 transcription factor jumonji (jmj) fami... 29 2.8 At5g55180.1 68418.m06879 glycosyl hydrolase family 17 protein si... 28 5.0 At4g37770.1 68417.m05346 1-aminocyclopropane-1-carboxylate synth... 28 5.0 At5g35380.1 68418.m04205 protein kinase family protein contains ... 27 6.5 At2g42830.1 68415.m05302 agamous-like MADS box protein AGL5 / fl... 27 8.7 >At2g41440.1 68415.m05120 expressed protein Length = 544 Score = 30.7 bits (66), Expect = 0.70 Identities = 20/73 (27%), Positives = 37/73 (50%) Frame = +1 Query: 103 YDKINLQEILENKRLLESYMDCVLGKGKCTPEGKELKDHLQEALETGCEKCTEAQEKGAE 282 ++ ++++ L+ RLL M C G PE LK HLQ AL ++ + ++ E Sbjct: 392 HEAVSMENELKRLRLLTRRMTCKDLDGLTFPELLSLKSHLQTALLIVKDQTKKIEQLLKE 451 Query: 283 TSIDYLIKNELEI 321 LI+++L++ Sbjct: 452 DDGWMLIRSQLQL 464 >At1g07550.1 68414.m00808 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 864 Score = 29.9 bits (64), Expect = 1.2 Identities = 19/60 (31%), Positives = 30/60 (50%) Frame = +1 Query: 142 RLLESYMDCVLGKGKCTPEGKELKDHLQEALETGCEKCTEAQEKGAETSIDYLIKNELEI 321 +++E M CV K P ++ L E LET CEK ++QE + ++ I + EI Sbjct: 801 KVVELAMSCVNRTSKERPNMSQVVHVLNECLET-CEKWRKSQEVDLSSPLELSIVVDTEI 859 >At1g08620.1 68414.m00955 transcription factor jumonji (jmj) family protein / zinc finger (C5HC2 type) family protein contains Pfam domains, PF02375: jmjN domain, PF02373: jmjC domain and PF02928: C5HC2 zinc finger Length = 1183 Score = 28.7 bits (61), Expect = 2.8 Identities = 15/54 (27%), Positives = 26/54 (48%) Frame = +1 Query: 205 ELKDHLQEALETGCEKCTEAQEKGAETSIDYLIKNELEIWKELTAHFDPDGKWR 366 ++K L + + GCE+C + Q K E +++Y+ K E K P W+ Sbjct: 107 DVKPALPKGVVRGCEECKDCQ-KEFEDTLNYIAKIRPEAEKYGICRIVPPPSWK 159 >At5g55180.1 68418.m06879 glycosyl hydrolase family 17 protein similar to elicitor inducible chitinase Nt-SubE76 GI:11071974 from [Nicotiana tabacum] Length = 460 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +1 Query: 133 ENKRLLESYMDCVLGKGKCTPEGKELKDHLQEALETGC 246 +NK + ++G+ C GK K+ LQE L+ C Sbjct: 355 DNKEKVVPVKPSLVGQTWCVANGKTTKEKLQEGLDYAC 392 >At4g37770.1 68417.m05346 1-aminocyclopropane-1-carboxylate synthase, putative / ACC synthase, putative similar to 1-aminocyclopropane-1-carboxylate synthase, Arabidopsis thaliana, GI:940370 [S71174] Length = 469 Score = 27.9 bits (59), Expect = 5.0 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = +2 Query: 308 MNWKFGRS*QPISTPTANGGRSTKTALRPRASSSLNKTSIKL 433 + W+ G PI +ANG R TK AL A K ++K+ Sbjct: 152 LKWRTGAEIVPIQCKSANGFRITKVALE-EAYEQAQKLNLKV 192 >At5g35380.1 68418.m04205 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 731 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/39 (30%), Positives = 24/39 (61%) Frame = +1 Query: 193 PEGKELKDHLQEALETGCEKCTEAQEKGAETSIDYLIKN 309 PE K+L+D +E+++ G + + + G+ TSI +I + Sbjct: 675 PELKKLRDLAEESIKFGVRQPSPIRSSGSATSIQEIISD 713 >At2g42830.1 68415.m05302 agamous-like MADS box protein AGL5 / floral homeodomain transcription factor (AGL5) identical to SP|P29385 Agamous-like MADS box protein AGL5 {Arabidopsis thaliana} Length = 246 Score = 27.1 bits (57), Expect = 8.7 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = +1 Query: 169 VLGKGKCTPEGKELKDHLQEALETGCEKCTEAQEKGAETSIDYLIKNELEI 321 +LG+ + KELK+ L+ LE G + + + I+Y+ K E+E+ Sbjct: 126 ILGESLGSLNFKELKN-LESRLEKGISRVRSKKHEMLVAEIEYMQKREIEL 175 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,232,553 Number of Sequences: 28952 Number of extensions: 191242 Number of successful extensions: 569 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 569 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1082538160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -