BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0299 (752 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04390.1 68417.m00627 Ulp1 protease family protein contains P... 29 4.4 At1g05680.1 68414.m00589 UDP-glucoronosyl/UDP-glucosyl transfera... 29 4.4 At5g53620.2 68418.m06662 expressed protein 28 7.7 At5g53620.1 68418.m06661 expressed protein 28 7.7 At5g24530.1 68418.m02897 oxidoreductase, 2OG-Fe(II) oxygenase fa... 28 7.7 >At4g04390.1 68417.m00627 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 963 Score = 28.7 bits (61), Expect = 4.4 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 1/57 (1%) Frame = +3 Query: 198 ELEYTSAFFTGVYGMWNIYIFALLVLYA-PSHKQWPAVEDTSDTQNLSEEIEFTPLQ 365 E+E + V G+ +Y L+VL A P+ K+ P EDT +++ E +E P Q Sbjct: 217 EVEQLATTSVDVQGL--LYALQLVVLQAAPAIKEGPVSEDTVCSESDEETLELIPRQ 271 >At1g05680.1 68414.m00589 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 453 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 315 YPQRLAIACDSEHTKPTMQICRCSTFHKLQ*KMLKY 208 YP L I D + I C+TF KL+ K+LK+ Sbjct: 184 YPNILRIVVDQLSNIDRVDIVLCNTFDKLEEKLLKW 219 >At5g53620.2 68418.m06662 expressed protein Length = 682 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +3 Query: 279 APSHKQWPAVEDTSDTQNL--SEEIEFTPLQERS 374 APS K+W AV D+ DT + E+++ ER+ Sbjct: 23 APSRKEWRAVSDSQDTTDYVDLEQLKLNRTDERT 56 >At5g53620.1 68418.m06661 expressed protein Length = 682 Score = 27.9 bits (59), Expect = 7.7 Identities = 13/34 (38%), Positives = 20/34 (58%), Gaps = 2/34 (5%) Frame = +3 Query: 279 APSHKQWPAVEDTSDTQNL--SEEIEFTPLQERS 374 APS K+W AV D+ DT + E+++ ER+ Sbjct: 23 APSRKEWRAVSDSQDTTDYVDLEQLKLNRTDERT 56 >At5g24530.1 68418.m02897 oxidoreductase, 2OG-Fe(II) oxygenase family protein similar to flavanone 3-hydroxylase [Persea americana][GI:727410]; contains PF03171 2OG-Fe(II) oxygenase superfamily domain Length = 341 Score = 27.9 bits (59), Expect = 7.7 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +2 Query: 203 GVYFSIFHWSLWNVEHLHICIVGFVCSESQAMAS 304 GVY S++H ++ N E+ + + F+C A+ S Sbjct: 262 GVYKSVWHRAVTNTENPRLSVASFLCPADCAVMS 295 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,197,927 Number of Sequences: 28952 Number of extensions: 266166 Number of successful extensions: 526 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 526 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -