BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0298 (848 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 24 1.7 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 24 1.7 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 2.3 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 22 5.3 EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive pep... 21 9.3 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 717 SLVSTNLYFVGYYCCQLLCIINCGGH 640 S L+ + +YC LL II GH Sbjct: 309 SFKEAGLFMIAFYCMTLLYIICNEGH 334 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -3 Query: 717 SLVSTNLYFVGYYCCQLLCIINCGGH 640 S L+ + +YC LL II GH Sbjct: 309 SFKEAGLFMIAFYCMTLLYIICNEGH 334 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 2.3 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 395 IFIFKVLFETKFNMYGGDNELDLLQ 321 I+ F + FNM D+E D++Q Sbjct: 208 IYAFATIDPHNFNMISNDDESDIIQ 232 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 22.2 bits (45), Expect = 5.3 Identities = 14/53 (26%), Positives = 24/53 (45%) Frame = -2 Query: 199 EVGQPTSKSSWRFQVQPRLTTNSPSMSFTNSARSKTGTRNDSFAIMMHNKLTR 41 E+G SS R + P+L+ S + N + T+ +I H++L R Sbjct: 461 ELGTNIYTSSKRQRTSPQLSPMSSLPPYPNRTQITEVTQQTEPSIYQHDQLLR 513 >EF222291-1|ABN79651.1| 374|Tribolium castaneum cardioactive peptide receptor 1 protein. Length = 374 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -2 Query: 736 SINKMYIFSIYKFVFRWLLLLSII 665 S++ Y F +F W+L + I+ Sbjct: 16 SLDAFYFFETEQFTLLWVLFVIIV 39 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,185 Number of Sequences: 336 Number of extensions: 3962 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23451794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -