BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0298 (848 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46640.1 68415.m05818 hypothetical protein and genefinder; e... 30 1.7 At1g55700.1 68414.m06378 DC1 domain-containing protein contains ... 28 6.8 >At2g46640.1 68415.m05818 hypothetical protein and genefinder; expression supported by MPSS Length = 310 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = -1 Query: 707 LQICISLAITVVNYYALLIAVGTSRWVIVPRYS*IQYYKILCTIPDTYL 561 +Q C+ + +TV Y LL + T V VP + YY ++C + TY+ Sbjct: 259 IQECVGIVMTVEMYCFLLTNI-TKLLVFVPVMHIVFYYYVICFLIYTYI 306 >At1g55700.1 68414.m06378 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 679 Score = 28.3 bits (60), Expect = 6.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 189 CPTSRNEANEVNLFCQTCDYD 251 C T ++ + +L C TCDYD Sbjct: 43 CRTKKHHRTKYHLHCDTCDYD 63 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,967,811 Number of Sequences: 28952 Number of extensions: 296370 Number of successful extensions: 621 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 621 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1970388800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -