BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0297 (690 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50311-9|AAA92313.1| 137|Caenorhabditis elegans Hypothetical pr... 27 9.6 U29535-11|AAK31456.1| 947|Caenorhabditis elegans Hypothetical p... 27 9.6 >U50311-9|AAA92313.1| 137|Caenorhabditis elegans Hypothetical protein C25E10.8 protein. Length = 137 Score = 27.5 bits (58), Expect = 9.6 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = +2 Query: 143 GHTPKTCLIYRCLDNA 190 G+TPK CL +C++NA Sbjct: 39 GYTPKVCLSAQCIENA 54 >U29535-11|AAK31456.1| 947|Caenorhabditis elegans Hypothetical protein C25H3.11 protein. Length = 947 Score = 27.5 bits (58), Expect = 9.6 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +2 Query: 521 IGKKTAFIVLYQVLFLPSTIKPGTILLVVGPLVSPR 628 +GK T + + + P T+K +L++VGPL S + Sbjct: 61 LGKLTLSVPITHIRSEPWTLKLSDVLIIVGPLSSEK 96 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,251,196 Number of Sequences: 27780 Number of extensions: 353913 Number of successful extensions: 785 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 775 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 785 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1581836700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -