BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0294 (799 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein... 137 4e-34 AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. 25 3.6 AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. 25 3.6 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 4.7 AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. 24 6.3 AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 24 6.3 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 8.3 >AY137766-1|AAM94344.1| 78|Anopheles gambiae heat shock protein 70 protein. Length = 78 Score = 137 bits (331), Expect = 4e-34 Identities = 65/75 (86%), Positives = 71/75 (94%) Frame = +3 Query: 447 NAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDL 626 +AVITVPAYFNDSQRQATKDAG I+GLNV+RIINEPTAAA+AYGLDK GERNVLIFDL Sbjct: 1 DAVITVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAALAYGLDKNLKGERNVLIFDL 60 Query: 627 GGGTFDVSILTIEDG 671 GGGTFDVSILTI++G Sbjct: 61 GGGTFDVSILTIDEG 75 >AY344831-1|AAR05802.1| 333|Anopheles gambiae ICHIT protein. Length = 333 Score = 24.6 bits (51), Expect = 3.6 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -1 Query: 706 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 608 W+ P T+ +P++ PPP + +T Sbjct: 221 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 253 >AY344829-1|AAR05800.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 24.6 bits (51), Expect = 3.6 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -1 Query: 706 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 608 W+ P T+ +P++ PPP + +T Sbjct: 222 WIDPTATTTTHVPTTTTTWSDLPPPPPTTTTTT 254 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 24.2 bits (50), Expect = 4.7 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +2 Query: 26 NGKSTRSRNRSGYHVLLRWCLPAREGGDHR--QRPG 127 +GK RS + +++LL P REG H+ Q PG Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHKAVQLPG 1837 >AY344835-1|AAR05806.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 6.3 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 706 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 608 W+ P T+ P++ PPP + +T Sbjct: 222 WIDPTATTTTHAPTTTTTWSDQPPPPPTTTTTT 254 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 23.8 bits (49), Expect = 6.3 Identities = 8/33 (24%), Positives = 14/33 (42%) Frame = -1 Query: 706 WVSPAVDFTSKIPSSMVRMDTSKVPPPRSKIST 608 W+ P T+ +P + PPP + +T Sbjct: 222 WIDPTATTTTHVPPTTTTWSDLPPPPPTTTTTT 254 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.4 bits (48), Expect = 8.3 Identities = 23/70 (32%), Positives = 35/70 (50%), Gaps = 14/70 (20%) Frame = -1 Query: 703 VSPAVDFTSKIPSSMVRMDTSKVPPP---RSKI---------STFRS-PVPF-LSRP*AI 566 +SP +F++ S++ ++ + PPP RSK T RS PVPF L+ P A Sbjct: 439 ISPPAEFSNGSSKSLLLLNGNGPPPPVPERSKTPNSIYLSQNGTPRSTPVPFALAPPPAA 498 Query: 565 AAAVGSLMIR 536 + A G +R Sbjct: 499 SPAFGDRSVR 508 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 918,868 Number of Sequences: 2352 Number of extensions: 20290 Number of successful extensions: 53 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 48 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 53 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 83992206 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -