BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0292 (757 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30600.2 68415.m03729 BTB/POZ domain-containing protein conta... 32 0.47 At2g30600.1 68415.m03728 BTB/POZ domain-containing protein conta... 32 0.47 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 31 0.83 At5g41250.1 68418.m05013 exostosin family protein contains Pfam ... 30 1.4 At2g04300.1 68415.m00422 leucine-rich repeat protein kinase, put... 29 2.5 At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family... 29 4.4 At3g07420.1 68416.m00884 asparaginyl-tRNA synthetase 2, cytoplas... 29 4.4 At4g14840.1 68417.m02281 expressed protein 28 5.8 At5g50400.1 68418.m06242 calcineurin-like phosphoesterase family... 28 7.7 At4g38770.1 68417.m05490 proline-rich family protein (PRP4) simi... 28 7.7 >At2g30600.2 68415.m03729 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to MigA (GI:1841872) [Dictyostelium discoideum] Length = 809 Score = 31.9 bits (69), Expect = 0.47 Identities = 37/139 (26%), Positives = 61/139 (43%), Gaps = 14/139 (10%) Frame = +1 Query: 85 DVATDDNLQYQFFPVSSGSVQFKVRAANDAHIAL--TTGPQ------ESDPMYEVMIGGW 240 + A D+L+++ G V F A ND + G Q ++ P Y V+IG Sbjct: 16 ECAWSDDLKFR--EAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSPHYIVIIGSN 73 Query: 241 GNAKSVIRKNRTKPDKVEIESPGILNGG-EYRGFWVRWDSGIISAGREGEAIPF----IS 405 N + I+ + V+ E+ + E++ +W+ G+IS G+ PF Sbjct: 74 RNRRLKIQVDGKSV--VDEEASDLCRCSLEFQSYWISIYDGLISIGK--GRYPFQNLVFK 129 Query: 406 WSDPEP-FPVYYVGVCTGW 459 W DP+P V YVG+ + W Sbjct: 130 WQDPKPNCNVQYVGL-SSW 147 >At2g30600.1 68415.m03728 BTB/POZ domain-containing protein contains Pfam PF00651: BTB/POZ domain; contains Interpro IPR000210/ PS50097: BTBB/POZ domain; similar to MigA (GI:1841872) [Dictyostelium discoideum] Length = 809 Score = 31.9 bits (69), Expect = 0.47 Identities = 37/139 (26%), Positives = 61/139 (43%), Gaps = 14/139 (10%) Frame = +1 Query: 85 DVATDDNLQYQFFPVSSGSVQFKVRAANDAHIAL--TTGPQ------ESDPMYEVMIGGW 240 + A D+L+++ G V F A ND + G Q ++ P Y V+IG Sbjct: 16 ECAWSDDLKFR--EAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSPHYIVIIGSN 73 Query: 241 GNAKSVIRKNRTKPDKVEIESPGILNGG-EYRGFWVRWDSGIISAGREGEAIPF----IS 405 N + I+ + V+ E+ + E++ +W+ G+IS G+ PF Sbjct: 74 RNRRLKIQVDGKSV--VDEEASDLCRCSLEFQSYWISIYDGLISIGK--GRYPFQNLVFK 129 Query: 406 WSDPEP-FPVYYVGVCTGW 459 W DP+P V YVG+ + W Sbjct: 130 WQDPKPNCNVQYVGL-SSW 147 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 31.1 bits (67), Expect = 0.83 Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 2/74 (2%) Frame = -1 Query: 724 EKERVYQGS--WHLREQHEPHTEVLLSSPVLPQRRQEVLDLLKHQPIYRLLQTEGVRFLR 551 E++R G + L EQ EP + ++ +L + EVL LL+ + TE + LR Sbjct: 587 EQQRTMLGENLYPLVEQLEPESAAKVTGMLLEMDQTEVLHLLESPEALKAKVTEAMDVLR 646 Query: 550 SLQGSQGGLRTMQL 509 S+ Q G QL Sbjct: 647 SVAQQQAGGAADQL 660 >At5g41250.1 68418.m05013 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 561 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/36 (36%), Positives = 23/36 (63%) Frame = -1 Query: 709 YQGSWHLREQHEPHTEVLLSSPVLPQRRQEVLDLLK 602 YQ +WHL E H ++ V +S + ++R V+++LK Sbjct: 473 YQYAWHLPEDHRKYS-VYISEQDVKEKRVNVVEILK 507 >At2g04300.1 68415.m00422 leucine-rich repeat protein kinase, putative similar to light repressible receptor protein kinase [Arabidopsis thaliana] gi|1321686|emb|CAA66376; contains leucine rich repeat (LRR) domains, Pfam:PF00560; contains protein kinase domain, Pfam:PF00069 Length = 851 Score = 29.5 bits (63), Expect = 2.5 Identities = 15/56 (26%), Positives = 27/56 (48%) Frame = +1 Query: 208 DPMYEVMIGGWGNAKSVIRKNRTKPDKVEIESPGILNGGEYRGFWVRWDSGIISAG 375 D ++ + +G ++S + T+ D V +PG L+ YR W+ S + S G Sbjct: 675 DEHFQAKLADFGLSRSFPLEGETRVDTVVAGTPGYLDPEYYRTNWLNEKSDVYSFG 730 >At3g52460.1 68416.m05769 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 300 Score = 28.7 bits (61), Expect = 4.4 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -3 Query: 428 GKGSGSDQDMNGIASPSRPAEIMPLSQRTQKPRYSPPLRIPG 303 G G S++D+N P P + P +TQ+ Y P + PG Sbjct: 16 GPGQNSERDIN--QPPPPPPQSQPPPPQTQQQTYPPVMGYPG 55 >At3g07420.1 68416.m00884 asparaginyl-tRNA synthetase 2, cytoplasmic / asparagine-tRNA ligase 2 (SYNC2) nearly identical to SP|Q9SW95; HMM hit: tRNA synthetases class II Length = 638 Score = 28.7 bits (61), Expect = 4.4 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = +1 Query: 223 VMIGGWGNAKSVIRKNRTKPDKVEIESPGILNGGE 327 V+IGGW + ++KN P + +P +GG+ Sbjct: 50 VVIGGWVKSARAVKKNSPPPPLPVVAAPSPSSGGD 84 >At4g14840.1 68417.m02281 expressed protein Length = 555 Score = 28.3 bits (60), Expect = 5.8 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +2 Query: 326 NIVVFGFVGIAALS--PLDARVKLFHSYLGLIPNLSQFTTSESAQAGVPQAP 475 +I V G+ A+S P+D + F SYL + NL Q SE+ Q P Sbjct: 294 HIYVSSMNGVIAVSHPPVDINPEEFDSYLNSLENLLQQQPSEAGQESSSSLP 345 >At5g50400.1 68418.m06242 calcineurin-like phosphoesterase family protein contains Pfam profile: PF00149 calcineurin-like phosphoesterase Length = 611 Score = 27.9 bits (59), Expect = 7.7 Identities = 21/73 (28%), Positives = 30/73 (41%), Gaps = 2/73 (2%) Frame = +1 Query: 199 QESDPMYEVMIGGWGNAKSVIRKNRTK--PDKVEIESPGILNGGEYRGFWVRWDSGIISA 372 Q +D + + GG N V N K + P + G ++ V W SG Sbjct: 135 QRADFSFALFTGGLSNPTLVSVSNHVSFINPKAPVY-PRLALGKKWDEMTVTWTSGY--- 190 Query: 373 GREGEAIPFISWS 411 GEA+PF+ WS Sbjct: 191 -NIGEAVPFVEWS 202 >At4g38770.1 68417.m05490 proline-rich family protein (PRP4) similar to proline-rich protein [Arabidopsis thaliana] gi|6782442|gb|AAF28388; contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 448 Score = 27.9 bits (59), Expect = 7.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 374 PAEIMPLSQRTQKPRYSPPLRIP 306 P E+ P ++ P+YSPP+ +P Sbjct: 171 PLELPPFLKKPCPPKYSPPVEVP 193 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,028,624 Number of Sequences: 28952 Number of extensions: 347886 Number of successful extensions: 1156 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1096 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1156 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -