BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0289 (780 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 23 2.7 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 23 2.7 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 23 2.7 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 23 3.6 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 3.6 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 22 4.8 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 22 4.8 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 8.4 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 21 8.4 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 21 8.4 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +1 Query: 412 DFKGIQMVLYSIVCTLHTFIFFLLYTFVLVFSQSIA 519 D+ + ++ + HTFI+ FV++ S ++A Sbjct: 207 DYNIVMALVLQFITLQHTFIWVFNDVFVMLLSTALA 242 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +1 Query: 412 DFKGIQMVLYSIVCTLHTFIFFLLYTFVLVFSQSIA 519 D+ + ++ + HTFI+ FV++ S ++A Sbjct: 207 DYNIVMALVLQFITLQHTFIWVFNDVFVMLLSTALA 242 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/36 (25%), Positives = 19/36 (52%) Frame = +1 Query: 412 DFKGIQMVLYSIVCTLHTFIFFLLYTFVLVFSQSIA 519 D+ + ++ + HTFI+ FV++ S ++A Sbjct: 207 DYNIVMALVLQFITLQHTFIWVFNDVFVMLLSTALA 242 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 22.6 bits (46), Expect = 3.6 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +3 Query: 186 RKERLIYLNLRMIMTKMLHIPYNINYFMNKCHVCCENL 299 + E++ +L+L I ++ I Y + F CHVCC + Sbjct: 623 QSEQIAWLHLLYIF--LVGIMYAADVFYI-CHVCCSTI 657 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 22.6 bits (46), Expect = 3.6 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 436 LYSIVCTLHTFIFFLLYTFVLVF 504 L ++C H F F+++T L+F Sbjct: 160 LLFLLCIYHFFCAFIIFTMHLLF 182 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.2 bits (45), Expect = 4.8 Identities = 12/36 (33%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = +2 Query: 122 GQHPPENVFV*I-QHLWTSYP-LKKGKINIFESKND 223 G+ PE++ + H+ ++ LKKGK++ FES ++ Sbjct: 104 GKFTPEHIIPDLCTHIIFAFGWLKKGKLSSFESNDE 139 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 22.2 bits (45), Expect = 4.8 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = -3 Query: 244 ICNILVIIILRFKYIN 197 +CN+L + +R+K +N Sbjct: 125 VCNVLTVFKIRYKDLN 140 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.4 bits (43), Expect = 8.4 Identities = 6/14 (42%), Positives = 11/14 (78%) Frame = -3 Query: 166 KMLNLYKNVFGWVL 125 +M+ L+ ++FGW L Sbjct: 227 EMVGLFNDIFGWPL 240 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +1 Query: 373 RIFGLLRSMSDCEDFKGIQMVLYSIVCTLHTFIFFLLY 486 RIFGL+ D F+ + + ++ T++ +LY Sbjct: 298 RIFGLVTFTPDRSKFRPSSLRFCLNILSIFTYVPMILY 335 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 21.4 bits (43), Expect = 8.4 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +1 Query: 373 RIFGLLRSMSDCEDFKGIQMVLYSIVCTLHTFIFFLLY 486 RIFGL+ D F+ + + ++ T++ +LY Sbjct: 23 RIFGLVTFTPDRSKFRPSSLRFCLNILSIFTYVPMILY 60 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 183,093 Number of Sequences: 336 Number of extensions: 4186 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21065107 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -