BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0289 (780 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5722| Best HMM Match : Ion_trans (HMM E-Value=0) 30 2.4 SB_17770| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 >SB_5722| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 1236 Score = 29.9 bits (64), Expect = 2.4 Identities = 16/68 (23%), Positives = 37/68 (54%), Gaps = 6/68 (8%) Frame = +1 Query: 373 RIFGLLRSMSDCEDFKGIQMVLYSIVCTL------HTFIFFLLYTFVLVFSQSIARIVGQ 534 R+F + R + E KG++ +L+++V +L T +F +++ + ++ S A + Sbjct: 822 RVFRIGRLLRFFEGAKGVRRLLFALVKSLPGLVNIATLLFLIIFIYAIIGMSSFAYVKKT 881 Query: 535 SGVKLVIN 558 +G+ V+N Sbjct: 882 NGITDVVN 889 >SB_17770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 28.3 bits (60), Expect = 7.4 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -3 Query: 184 QRV*SPKMLNLYKNVFGWVLARHQTRGPDERRTWNNAPR 68 Q + P ++ Y+ W RH+T+ D R WN+ P+ Sbjct: 29 QAIDRPLCMSCYRYARAW-RRRHRTQDEDTTRGWNSRPK 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,962,796 Number of Sequences: 59808 Number of extensions: 447708 Number of successful extensions: 1004 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1001 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2131907602 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -