BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0285 (792 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 22 5.7 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 7.5 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 21 9.9 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.2 bits (45), Expect = 5.7 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -2 Query: 143 CTSMFIVVIYYLSC 102 C S+ + +YY+SC Sbjct: 178 CISILAIKVYYISC 191 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.8 bits (44), Expect = 7.5 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = -2 Query: 734 CFEEPAKGQDLPG 696 CFEEP LPG Sbjct: 470 CFEEPLPSLPLPG 482 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 21.4 bits (43), Expect = 9.9 Identities = 9/48 (18%), Positives = 19/48 (39%) Frame = -2 Query: 248 LACNSSFKHLCVFGAKLHIIASVPCQIKLSNNTRYCTSMFIVVIYYLS 105 L C +S LC ++ + P ++ + IV ++ L+ Sbjct: 120 LLCTASILSLCAISIDRYLAVTQPLIYSRRRRSKRLAGLMIVAVWVLA 167 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,503 Number of Sequences: 438 Number of extensions: 4424 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -