BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0284 (741 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15046| Best HMM Match : IlvB_leader (HMM E-Value=4.4) 29 3.0 SB_3932| Best HMM Match : Spectrin (HMM E-Value=5.2e-17) 28 9.1 >SB_15046| Best HMM Match : IlvB_leader (HMM E-Value=4.4) Length = 123 Score = 29.5 bits (63), Expect = 3.0 Identities = 15/40 (37%), Positives = 23/40 (57%) Frame = +1 Query: 196 WLIDLKKKKIGTQSSRMCIFTINFKIYDVTFVLYFIYTNQ 315 WLI K K+ +++R C+FT+ + + FVL Y NQ Sbjct: 25 WLI---KNKLSVKNTRRCVFTVGCTVASI-FVLATGYANQ 60 >SB_3932| Best HMM Match : Spectrin (HMM E-Value=5.2e-17) Length = 1426 Score = 27.9 bits (59), Expect = 9.1 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +3 Query: 15 KMKTSRDEHSNKKKKKNDHFTHFTNLLAAQVPPVMKDCFHD 137 + K D+ ++KK+K D F FTN L+A PVM D D Sbjct: 1247 EFKKVADDVTSKKRKVTD-FDRFTNKLSAD--PVMDDVSRD 1284 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,850,078 Number of Sequences: 59808 Number of extensions: 326418 Number of successful extensions: 573 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 543 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 573 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1998111622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -