BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0284 (741 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 24 4.3 AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. 23 7.5 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 24.2 bits (50), Expect = 4.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 446 SDALNRESPEP*KSQMCNKYYFI 378 S+ L + SP P +MCN+ Y I Sbjct: 391 SETLRKWSPSPGTDRMCNQDYTI 413 >AF008575-1|AAB87764.1| 525|Anopheles gambiae chitinase protein. Length = 525 Score = 23.4 bits (48), Expect = 7.5 Identities = 12/38 (31%), Positives = 19/38 (50%) Frame = +3 Query: 3 EGTPKMKTSRDEHSNKKKKKNDHFTHFTNLLAAQVPPV 116 +G P + RD H+ ++ + F H+ LL A V V Sbjct: 163 DGNPLI--DRDNHAQLVEEMREEFDHYGLLLTAAVASV 198 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 655,048 Number of Sequences: 2352 Number of extensions: 12509 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 76091949 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -