BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0283 (733 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 25 0.48 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 25 0.48 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 25 0.48 AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory recept... 22 4.4 AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory recept... 22 4.4 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 314 HCYAYIFNLKYLILLSLFSIMQIMESSYLSTY 219 +C AYI ++ LSL ++Q M ++Y TY Sbjct: 218 NCSAYIIAHYRVLWLSLSDLLQKMGNAYARTY 249 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 314 HCYAYIFNLKYLILLSLFSIMQIMESSYLSTY 219 +C AYI ++ LSL ++Q M ++Y TY Sbjct: 218 NCSAYIIAHYRVLWLSLSDLLQKMGNAYARTY 249 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 25.4 bits (53), Expect = 0.48 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = -3 Query: 314 HCYAYIFNLKYLILLSLFSIMQIMESSYLSTY 219 +C AYI ++ LSL ++Q M ++Y TY Sbjct: 218 NCSAYIIAHYRVLWLSLSDLLQKMGNAYARTY 249 >AM292334-1|CAL23146.2| 390|Tribolium castaneum gustatory receptor candidate 13 protein. Length = 390 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 541 IKFYTKMFYSLILA 500 +KFY + FY +ILA Sbjct: 96 VKFYVQKFYVVILA 109 >AM292333-1|CAL23145.2| 316|Tribolium castaneum gustatory receptor candidate 12 protein. Length = 316 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 541 IKFYTKMFYSLILA 500 +KFY + FY +ILA Sbjct: 22 VKFYVQKFYVVILA 35 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,133 Number of Sequences: 336 Number of extensions: 4131 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -