BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0283 (733 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25773| Best HMM Match : 7tm_1 (HMM E-Value=1.68156e-44) 28 6.8 SB_55427| Best HMM Match : E-MAP-115 (HMM E-Value=0.077) 28 9.0 >SB_25773| Best HMM Match : 7tm_1 (HMM E-Value=1.68156e-44) Length = 906 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -2 Query: 276 TLKPILHHANNGEQLFKHIHINKFY--AKYNTKKKYICNLIFVQYRLLLFPY 127 T + IL H + Q FK ++ + K T + C LIFV YR L+ Y Sbjct: 227 TRRDILFHTSRMRQEFKIKNVKLDFPDVKSFTTSPWFCQLIFVIYRTLVALY 278 >SB_55427| Best HMM Match : E-MAP-115 (HMM E-Value=0.077) Length = 599 Score = 27.9 bits (59), Expect = 9.0 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = -2 Query: 222 IHINKFYAKYNTKKKYICNLIFVQYRLLL 136 +H+NK K+N I ++IF++Y+ +L Sbjct: 511 MHVNKLMLKFNPSYNKIDSIIFLRYQTML 539 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,317,852 Number of Sequences: 59808 Number of extensions: 400587 Number of successful extensions: 608 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 608 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -