BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0282 (718 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4FN70 Cluster: Putative uncharacterized protein; n=2; ... 33 7.0 UniRef50_Q7RFB6 Cluster: Putative uncharacterized protein PY0479... 33 9.3 >UniRef50_Q4FN70 Cluster: Putative uncharacterized protein; n=2; Candidatus Pelagibacter ubique|Rep: Putative uncharacterized protein - Pelagibacter ubique Length = 449 Score = 33.1 bits (72), Expect = 7.0 Identities = 23/82 (28%), Positives = 45/82 (54%) Frame = +3 Query: 153 FEFRKLVLMFVGRLEKKKTLFMLIVLPAWLFVLLRLQGRSFYPSNH*FVFCRNIMFKEFL 332 F F LMF + +K+ LFM++V+ A+L++ + ++ ++ P ++ +F F F+ Sbjct: 154 FLFISCTLMFTSKNKKELALFMILVILAFLYI-VEVRSKNNLPISYKLIF--YFYFLSFI 210 Query: 333 VFFCI*FIDLMQFCNFFRNSII 398 V CI F++L F +I+ Sbjct: 211 V--CI-FLNLKNKLTFINVTIL 229 >UniRef50_Q7RFB6 Cluster: Putative uncharacterized protein PY04791; n=1; Plasmodium yoelii yoelii|Rep: Putative uncharacterized protein PY04791 - Plasmodium yoelii yoelii Length = 574 Score = 32.7 bits (71), Expect = 9.3 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 634 ILLTGTYLLLCTSLVFIYFYNLNT*KICDFHI 539 I+L L C ++++IYFY N KIC F I Sbjct: 473 IILKKVKLKKCKNMIYIYFYGENNFKICKFKI 504 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 641,139,145 Number of Sequences: 1657284 Number of extensions: 12142006 Number of successful extensions: 26193 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25080 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26189 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 57851245060 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -