BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0282 (718 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0971 + 7498971-7499477,7499578-7499715,7500653-7500732,750... 28 6.4 05_05_0016 - 21542300-21542886,21542956-21543286,21543310-215434... 28 8.5 >06_01_0971 + 7498971-7499477,7499578-7499715,7500653-7500732, 7501175-7501584,7503650-7503834,7504280-7504365, 7504641-7504774,7506491-7506790,7506999-7507147, 7507762-7507845 Length = 690 Score = 28.3 bits (60), Expect = 6.4 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +2 Query: 173 FDVCW*IRKKKNAFYVDCVACLVVCVITVAGSIFLSIKSLIRIL 304 FD W + NAFY D CL V + + I ++ LI+IL Sbjct: 400 FDSYWKYKSTPNAFYEDAEKCLRVALYSTP-PIMAALLPLIQIL 442 >05_05_0016 - 21542300-21542886,21542956-21543286,21543310-21543419, 21543526-21544069,21544190-21544345 Length = 575 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = -3 Query: 224 NQHKKRFFFF*STNKHQNQFSKFKTRLDF*EHSK 123 N H + F +F S +++ Q SKF RL+F HSK Sbjct: 82 NPHAEDFAYFHSISRYTKQNSKF-GRLNFYPHSK 114 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,730,009 Number of Sequences: 37544 Number of extensions: 277223 Number of successful extensions: 445 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 444 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -