BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0281 (661 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7R3E1 Cluster: Chromosome undetermined scaffold_507, w... 34 3.5 UniRef50_A5APH4 Cluster: Putative uncharacterized protein; n=2; ... 34 3.5 >UniRef50_A7R3E1 Cluster: Chromosome undetermined scaffold_507, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome undetermined scaffold_507, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 499 Score = 33.9 bits (74), Expect = 3.5 Identities = 18/55 (32%), Positives = 29/55 (52%) Frame = -1 Query: 607 QLYGTNSTLHYIYYSIKAFCITIIVHPCGTRSLAHYIQHYVHRQSKKKKNHLHQK 443 + +G+ STL Y+ S FC +I H G S HY+ Y+ + +K+ L+ K Sbjct: 28 EFFGSLSTLRYLNLSSAGFC-GVIPHQLGNSSKLHYL--YIGKSDYYRKDSLNAK 79 >UniRef50_A5APH4 Cluster: Putative uncharacterized protein; n=2; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 381 Score = 33.9 bits (74), Expect = 3.5 Identities = 18/55 (32%), Positives = 29/55 (52%) Frame = -1 Query: 607 QLYGTNSTLHYIYYSIKAFCITIIVHPCGTRSLAHYIQHYVHRQSKKKKNHLHQK 443 + +G+ STL Y+ S FC +I H G S HY+ Y+ + +K+ L+ K Sbjct: 55 EFFGSLSTLRYLNLSSAGFC-GVIPHQLGNSSKLHYL--YIGKSDYYRKDSLNAK 106 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 566,718,666 Number of Sequences: 1657284 Number of extensions: 9861043 Number of successful extensions: 27509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 26280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27483 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 50000004659 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -