BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0278 (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27597| Best HMM Match : Cytochrom_B_N (HMM E-Value=0) 47 2e-05 >SB_27597| Best HMM Match : Cytochrom_B_N (HMM E-Value=0) Length = 135 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/50 (42%), Positives = 31/50 (62%) Frame = +3 Query: 48 YVLP*GQISFWGATVITNLLSAIPYLGTILVN*I*GGFAVDNATLTRFYT 197 Y LP QI +W ++T + AIP +G+ LV + G +V +TLTRFY+ Sbjct: 64 YSLPRDQIGYWAVKIVTGVPEAIPVIGSPLVELLRGSASVGQSTLTRFYS 113 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,398,196 Number of Sequences: 59808 Number of extensions: 178005 Number of successful extensions: 289 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 246 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 289 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -