BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0277 (621 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6907| Best HMM Match : PAN (HMM E-Value=0.019) 33 0.25 SB_29300| Best HMM Match : GFO_IDH_MocA (HMM E-Value=2.1e-17) 33 0.25 SB_1834| Best HMM Match : efhand (HMM E-Value=1e-06) 32 0.33 SB_22681| Best HMM Match : PAN (HMM E-Value=0.0027) 30 1.3 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_12271| Best HMM Match : DUF1079 (HMM E-Value=1.2) 29 2.3 SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.3 SB_34658| Best HMM Match : SUI1 (HMM E-Value=1e-06) 28 7.0 SB_22890| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00078) 28 7.0 SB_12951| Best HMM Match : Radial_spoke_3 (HMM E-Value=0) 28 7.0 SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_25016| Best HMM Match : PDZ (HMM E-Value=5.6e-08) 27 9.3 SB_38761| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 >SB_6907| Best HMM Match : PAN (HMM E-Value=0.019) Length = 324 Score = 32.7 bits (71), Expect = 0.25 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 201 SSETHCRFGFEEPSNCTCEATY 266 SS CR G+E+P CTC+ Y Sbjct: 130 SSHRACRIGYEDPFRCTCQRNY 151 >SB_29300| Best HMM Match : GFO_IDH_MocA (HMM E-Value=2.1e-17) Length = 634 Score = 32.7 bits (71), Expect = 0.25 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 201 SSETHCRFGFEEPSNCTCEATY 266 SS CR G+E+P CTC+ Y Sbjct: 433 SSHRACRIGYEDPFRCTCQMNY 454 >SB_1834| Best HMM Match : efhand (HMM E-Value=1e-06) Length = 659 Score = 32.3 bits (70), Expect = 0.33 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +1 Query: 214 IADSDLKNRATVPVKPPTVSETSSVYFDPLVNKVINHVMEK 336 ++D K+RA P KP + SSV D L+ ++ +HV+ K Sbjct: 220 LSDKMNKDRAQTPPKPSPPLDLSSVDLDELIQRIRHHVLVK 260 >SB_22681| Best HMM Match : PAN (HMM E-Value=0.0027) Length = 329 Score = 30.3 bits (65), Expect = 1.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 216 CRFGFEEPSNCTCEATY 266 CR G+EEP CTC Y Sbjct: 143 CRIGYEEPYRCTCGKNY 159 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 29.9 bits (64), Expect = 1.7 Identities = 19/71 (26%), Positives = 35/71 (49%) Frame = +1 Query: 304 VNKVINHVMEKGNKRLARQLVEKAFENIKRKQIERYHLASTPEEKAKIELNPKDILYKAV 483 +N+++NH E +K++ KA + +K + TPEE++K ++ P + Sbjct: 565 INRIMNH-REGYDKKI------KAKKGKNKKSKKTLPTGDTPEEESKPDIEPAQPIPTPQ 617 Query: 484 ENCKPLLQLQP 516 NCK + QP Sbjct: 618 VNCKERYEKQP 628 >SB_12271| Best HMM Match : DUF1079 (HMM E-Value=1.2) Length = 1716 Score = 29.5 bits (63), Expect = 2.3 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 1/88 (1%) Frame = +1 Query: 217 ADSDLKNRATVPVKPPTVSETSSVYFDPLVNKVINHVMEKGNKRLARQLVEKAFENIKRK 396 A SDL+ RAT ++ + S++ +P N V H L++ + Sbjct: 178 ATSDLQKRATELLEKSETTLDSTISTEPFPNLVKPH------------LIQAPLKQTSVS 225 Query: 397 QIERYHLASTPEEKAKIELNPK-DILYK 477 Q E + A P K K ++NP+ DILY+ Sbjct: 226 QPETHIAAPNPSYKQKRDINPENDILYQ 253 >SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 699 Score = 28.7 bits (61), Expect = 4.0 Identities = 20/39 (51%), Positives = 24/39 (61%) Frame = +1 Query: 289 YFDPLVNKVINHVMEKGNKRLARQLVEKAFENIKRKQIE 405 YFDPL KV++ M N LARQ ++A E IKR Q E Sbjct: 503 YFDPLKTKVVHFSMNPSN--LARQ--QRA-EEIKRLQDE 536 >SB_2559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1324 Score = 28.7 bits (61), Expect = 4.0 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +1 Query: 364 VEKAFENIKRKQIERYHLASTPEEKAKI 447 +++AFE ++ + + + +A T EEKAKI Sbjct: 22 LQEAFEKFRKSRQKEFKIAKTMEEKAKI 49 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 28.3 bits (60), Expect = 5.3 Identities = 26/90 (28%), Positives = 37/90 (41%), Gaps = 7/90 (7%) Frame = +1 Query: 220 DSDLKNRATVPVKPPTVSETSSVYFDPLVNKVINHVMEKGNKRLARQLVEKAFENIKRKQ 399 D + A+ + T E D K ++ + +RL QL E N+K + Sbjct: 1872 DDESDEPASEEAEEKTKEEKLKSMLDSSKLKTEAKILREETERLKAQLEETM--NLKEEL 1929 Query: 400 IERYHLAS-------TPEEKAKIELNPKDI 468 ++ H A T EEKAKIE KDI Sbjct: 1930 QDKLHTAEHELFEARTSEEKAKIEHRDKDI 1959 >SB_34658| Best HMM Match : SUI1 (HMM E-Value=1e-06) Length = 798 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/48 (22%), Positives = 24/48 (50%) Frame = +1 Query: 196 EDQVKLIADSDLKNRATVPVKPPTVSETSSVYFDPLVNKVINHVMEKG 339 ED VK++A + + P ++S+ P++N+++N + G Sbjct: 537 EDDVKILAHKPISKSCNLDPLPTSLSKGCFSTLLPIINRIVNASLSSG 584 >SB_22890| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.00078) Length = 788 Score = 27.9 bits (59), Expect = 7.0 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +2 Query: 347 DWLVNSLRKHSKISKGNKLNDTIWLLHQKKKPK*S*ILRTFYIKPLKIANH-CYNYSPIK 523 D +N+L++H K ++ +D +WL +K K ILR +K +++ Y P++ Sbjct: 533 DMYMNNLKEHHPHHK-DRFSDQVWLFQGRKADKNLRILRERILKLTRLSKEIIYGSEPLQ 591 >SB_12951| Best HMM Match : Radial_spoke_3 (HMM E-Value=0) Length = 374 Score = 27.9 bits (59), Expect = 7.0 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +1 Query: 289 YFDPLVNKVINHVMEKGNKRLARQLVEKAFENIKRKQIERYHLASTPEEKAKIE 450 ++DP+ +I HV+ K RQ V + R +E+ +A E+K KIE Sbjct: 278 FYDPVERAIIRHVVTK------RQQVYGKLDEELRLSMEKEIMARAAEQKKKIE 325 >SB_49862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 639 Score = 27.5 bits (58), Expect = 9.3 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +1 Query: 385 IKRKQIERYHLASTPEEKAKIELNPKDILYKAVENCKPLLQLQPHQEG 528 +K+ ++ RY A + KAKI +PKD L + + L+ Q EG Sbjct: 249 VKKAELRRY-TAKNIKNKAKINEDPKDALLREFQKEIEKLKAQLGDEG 295 >SB_25016| Best HMM Match : PDZ (HMM E-Value=5.6e-08) Length = 816 Score = 27.5 bits (58), Expect = 9.3 Identities = 19/80 (23%), Positives = 35/80 (43%) Frame = +1 Query: 289 YFDPLVNKVINHVMEKGNKRLARQLVEKAFENIKRKQIERYHLASTPEEKAKIELNPKDI 468 Y L+ K V++ + + ++ +A R R HLAS ++ AK + Sbjct: 552 YLRKLLKKKEEEVLDTSEEAIKSRMEAQALLEESRSLQNRIHLASQAQKAAKDMEQDYEE 611 Query: 469 LYKAVENCKPLLQLQPHQEG 528 + K +E L+L+ Q+G Sbjct: 612 VIKLLEKEMAALKLKLEQKG 631 >SB_38761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 27.5 bits (58), Expect = 9.3 Identities = 10/28 (35%), Positives = 21/28 (75%) Frame = +1 Query: 76 RRLKNSSFNSSTRTLSKLQIRNYAKATS 159 +++ + ++N +T+TL +QI NY+ +TS Sbjct: 77 QKITSFAYNGNTKTLRTVQIGNYSYSTS 104 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,751,671 Number of Sequences: 59808 Number of extensions: 359685 Number of successful extensions: 1052 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1051 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1536271375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -