BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0274 (708 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q1Z3D7 Cluster: Putative uncharacterized protein; n=1; ... 33 6.9 UniRef50_Q05FV6 Cluster: Putative uncharacterized protein; n=1; ... 33 6.9 >UniRef50_Q1Z3D7 Cluster: Putative uncharacterized protein; n=1; Photobacterium profundum 3TCK|Rep: Putative uncharacterized protein - Photobacterium profundum 3TCK Length = 282 Score = 33.1 bits (72), Expect = 6.9 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 304 KMIYMQLSRNWLNKVKLDKV*TKGFYYHRHEYKKVKLDKV 185 KM + LS NW++K DK+ K H+ K +LDKV Sbjct: 190 KMEVVDLSMNWIHKDGEDKIDLKNATKHKSRAKSTRLDKV 229 >UniRef50_Q05FV6 Cluster: Putative uncharacterized protein; n=1; Candidatus Carsonella ruddii PV|Rep: Putative uncharacterized protein - Carsonella ruddii (strain PV) Length = 275 Score = 33.1 bits (72), Expect = 6.9 Identities = 19/59 (32%), Positives = 33/59 (55%) Frame = +2 Query: 62 LHVDHFSKNKAIKKFHFLRVYTSTRTHFFVFMSMIIKSFCLNFI*FNFFVFMSMIIKSF 238 L++ F KN +K +++ + + +F++F S II F +FI F+F S+ IK F Sbjct: 89 LNIYFFIKNCFLK----IKIISKNKINFYIFFSKIIFFFKYSFIKIICFLFCSLFIKFF 143 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 528,327,066 Number of Sequences: 1657284 Number of extensions: 9305086 Number of successful extensions: 17269 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15442 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17226 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 56611575523 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -