BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0274 (708 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81479-8|CAB03946.1| 1181|Caenorhabditis elegans Hypothetical pr... 29 3.3 Z72505-2|CAA96609.1| 340|Caenorhabditis elegans Hypothetical pr... 27 9.9 >Z81479-8|CAB03946.1| 1181|Caenorhabditis elegans Hypothetical protein C34F6.9 protein. Length = 1181 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +3 Query: 504 RNKITFLNNFKGILL*FPQMYITNNSH*QKAKVCSRSECVFKNLT 638 RN + + + +L+ PQ+Y SH K + +RSEC LT Sbjct: 874 RNTLCYAISMVQLLMRVPQVYSIVRSHSHKKQKANRSECFLCMLT 918 >Z72505-2|CAA96609.1| 340|Caenorhabditis elegans Hypothetical protein C50C10.3 protein. Length = 340 Score = 27.5 bits (58), Expect = 9.9 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = +1 Query: 358 THTFFFFLNYLHYSSTNTHLSFPRTGL 438 T F+FF N L + HL+ P +GL Sbjct: 71 TIMFYFFFNILFFIGDYVHLNLPSSGL 97 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,129,702 Number of Sequences: 27780 Number of extensions: 253653 Number of successful extensions: 472 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 472 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1645110168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -