BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0274 (708 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 22 6.6 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 21.8 bits (44), Expect = 6.6 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +3 Query: 366 IFFFFKLPTLLFYKYSFKFSSHWLVKRQ*LPQ 461 I FF L T+L + + ++W + + LPQ Sbjct: 6 IIRFFVLTTMLMMAIAVELPNNWRICDRSLPQ 37 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,390 Number of Sequences: 438 Number of extensions: 3122 Number of successful extensions: 1 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -