BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0272 (790 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 5.7 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 5.7 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 21 9.9 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 21 9.9 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 9.9 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.2 bits (45), Expect = 5.7 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +2 Query: 530 KQGSHSYHFLMLRNVLECRNT 592 K H+ L LRN+++ RNT Sbjct: 83 KMAKHAAAELALRNIVQFRNT 103 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 22.2 bits (45), Expect = 5.7 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = -2 Query: 204 VRFTSNLSRRNPFGGARVRHNVMVTRPNRCIATISKHYCWF 82 + T +RRNP+ H+ PN + +K+Y F Sbjct: 413 LNLTVENNRRNPWFVEFWEHHFQCRYPNASVTPYNKNYTKF 453 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 699 LELIRTTECQSETNTGK 649 LE T C S+TNTG+ Sbjct: 211 LEKFFTDYCNSKTNTGE 227 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 21.4 bits (43), Expect = 9.9 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = -2 Query: 699 LELIRTTECQSETNTGK 649 LE T C S+TNTG+ Sbjct: 211 LEKFFTDYCNSKTNTGE 227 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 9.9 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 749 KMLLQHIKERLQNQIH 702 +MLL+H K R + IH Sbjct: 149 EMLLEHKKRRARRDIH 164 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 218,430 Number of Sequences: 438 Number of extensions: 4540 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24882285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -