BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= an--0269 (745 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr... 25 8.6 SPAC13G7.07 |arb2||argonaute binding protein 2|Schizosaccharomyc... 25 8.6 >SPAC4G8.03c |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 780 Score = 25.4 bits (53), Expect = 8.6 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +2 Query: 116 ESCFSSILNSSENVTSITNLNI 181 ES FSS+++ + S+ NLNI Sbjct: 207 ESSFSSLIDEESKLASLRNLNI 228 >SPAC13G7.07 |arb2||argonaute binding protein 2|Schizosaccharomyces pombe|chr 1|||Manual Length = 266 Score = 25.4 bits (53), Expect = 8.6 Identities = 13/42 (30%), Positives = 23/42 (54%) Frame = -1 Query: 718 VLAKCLQHLIMITIELPSAKMYEKCIKNF*EYFQYINKIGTE 593 V+AKC + + + I PSA ++++ I NF +Y G + Sbjct: 137 VIAKCTEKKLSVVIFSPSALLWDQSI-NFPRTTRYFTSQGLQ 177 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,704,710 Number of Sequences: 5004 Number of extensions: 52800 Number of successful extensions: 284 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 281 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 353266144 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -